The x509-mode package has been updated to version 20241111.1812.

The haskell-mode package has been updated to version 20241111.1514.

The inhibit-mouse package has been updated to version 20241111.1500.

The docker package has been updated to version 20241111.859.

The ejc-sql package has been updated to version 20241111.117.

The call-graph package has been updated to version 20241111.117.

I live in Serbia and am learning the local language, which is why I created this app. I used to use Quizlet, but I wanted something in Emacs because I prefer not to leave Emacs and like to keep my material in text files in my computer. In my opinion, it's better to store all learning material in plain text rather than a centralized app. Maybe someone else will find this useful too. Repository link https://github.com/Prikaz98/foreign submitted by /u/Cautious_Truth_9094 [link] [comments]

I have a TypeScript file, with typescript-ts-mode and eglot enabled. After running imenu-add-menubar-index, I can see the populated Index menu in the menu bar. However, the items in the menu/submenus are sorted alphabetically. Is there any way to have the items sorted according to their respective positions in the file? I tried customizing imenu-sort-function to imenu--sort-by-position, but the list is still alphabetically sorted. Thank you in advance! submitted by /u/hectorhonn [link] [comments]

Check my config at the bottom. The issue I am having is angular language server is running, but I am not getting any of the normal tsserver support. Also, not all angular errors show. See image https://preview.redd.it/f8z38wg7qa0e1.png?width=1318&format=png&auto=webp&s=407f1fef9a87aaab88e5cb237c490f4b574689f6 My eglot config is as follows... (defvar nodeModules "/home/me/.nvm/versions/node/v22.9.0/lib/node_modules/") (add-to-list 'eglot-server-programs `((typescript-mode) . ("node" ,(concat nodeModules "@angular/language-server") "--tsProbeLocations" ,(concat nodeModules "typescript-language-server/lib") "--ngProbeLocations" ,(concat nodeModules "@angular/language-server/bin/") "--stdio" ))) I tried the package ng2-mode. But when active, I get no language server support either. I am using debian 12. submitted by /u/BuilderMax21 [link] [comments]

Say you have two buffers open, one source the other for build failures from a Makefile. Is there a simple key combination to move from one error to the next rather than jumping between buffers and selecting the next error? Thanks ahead of time. submitted by /u/guymadison42 [link] [comments]

I've set, ⁣ butproject-vc-ignores but I doubt that's the correct variable to modify. Here is my configuration for project.el (use-package project :ensure t :config (setq project-vc-extra-root-markers '("Cargo.toml" "compile_commands.json" "compile_flags.txt" "go.mod" "project.godot")) (setq project-vc-ignores '("nix/store/" "node_modules/" "go/pkg/" ".direnv/" "vendor/"))) submitted by /u/No_Cartographer1492 [link] [comments]

How to jump lines with relative lines? [-_-] I mean, up or down. submitted by /u/Elav_Avr [link] [comments]

I was trying to setup a keybinding which will list all the available code actions for any code segment. I tried lsp-execute-code-action function, but it applies code action immediately if there is only one code action. I just don't want to blindly apply any code action without knowing what it is going to do with my code. NOTE: I use lsp-ui which has an option to show code actions in the sideline. But it feels cluttered to me. submitted by /u/Rid1_fz_06 [link] [comments]

I'm getting so over using the AWS AppSync console. I want to execute graphql queries directly from Emacs. Is there some Emacs mode or code for this? submitted by /u/berenddeboer [link] [comments]

submitted by /u/Shawn-Yang25 [link] [comments]

[SOLVED] Hi, code sample is below. It says on hoogle docs that there are instances of MonadCatch and MonadThrow for RWST r w s m (and in my case m is IO, which itself has instances for MonadCatch and MonadThrow), but i get mistakes that there is no instance of MonadCatch / MonadThrow for (RSWT String [String] Int IO) module Repl where import Control.Monad.Catch import Control.Monad.Trans.RWS.CPS data Err = Err String deriving (Show) instance Exception Err type Repl a = RWST String [String] Int IO a repl :: Repl () repl = catch action errHandler errHandler :: Err -> Repl () errHandler err = tell [show err] action :: Repl () action = throwM $ Err "Exception" submitted by /u/Tempus_Nemini [link] [comments]

Hello everyone! I'm hosting a Haskell meetup in Stockholm on the 2nd of December! This is a special "Christmas edition" meetup, so we'll be serving some Swedish mulled wine and holiday snacks. Please come by if you're in town! Leave your RSVP at the Meetup event page: https://www.meetup.com/haskell-stockholm/events/304393557 submitted by /u/JohnyTex [link] [comments]

I'm currently in the process of selecting a topic for my final year project (FYP) and am considering the implementation of an HTTP server. While I'm not very familiar with Haskell – having only read "Learn You a Haskell for Great Good!" – I am drawn to the principles of functional programming. My primary focus is on web development, and I believe that building an HTTP server from scratch would provide me with valuable low-level knowledge in this domain. I'm thinking of titling my project "Development of an HTTP Server in the Paradigm of Functional Programming." In this project, I intend to emphasize the functional programming paradigm and its benefits rather than focusing solely on the implementation. I understand that this implementation will not be production-ready, but I view it as a research project. I would appreciate any advice you might have, particularly regarding the use of the WAI. While I believe that using WAI could effectively demonstrate the advantages of functional programming, I am unsure if it is essential for my project's theme. Additionally, considering my time constraints and current knowledge, I believe I should focus solely on HTTP/1.1? submitted by /u/TheLerny [link] [comments]

Here is my usecase and how I intend to solve this. Please let me know if there is a more elegant way to do this or preexisting solutions. I have recently gotten better about documenting stuff I change in my environment. I do this in org with org-roam. Often I change some config file and want to reference what exactly I changed in my documentation, too. Previously I just inserted a link to the file, but my org zettelkasten will probably outlive the current setup. Also when files change, the documentation might become out of date because the link is no longer relevant and doesnt contain the relevant changes anymore. So my proposal is a function that inserts a link to a snapshot of the file. The snapshot of the file is just a copy of the file that is stored in ~/org/dotfile-snapshots, that has a filename with a datetime prefix. This way you know when the snapshot happened and also have a unique name and can snapshot that specific file in the future again. Finally it writes the full filepath to some metadata file. submitted by /u/Pentaquark1 [link] [comments]

The recall package has been updated to version 20241110.2300.

The lambdapi-mode package has been updated to version 20241110.1640.

The repl-driven-development package has been updated to version 20241110.1611.

The kubel package has been updated to version 20241110.1456.

The rg package has been updated to version 20241110.1225.

The app-monochrome-themes package has been updated to version 20241110.1142.

The magit-commit-mark package has been updated to version 20241110.245.

I was rewriting from scratch again b/c reasons, and I couldn't help myself. ;;; Commentary: ;; This is my init.el. There are many like it but this one is mine. ;; My init.el is my best friend. It is my life. I must master it as ;; I master my life. ;; My init.el, without me, is useless. Without my init.el, I am ;; useless. I must write my init.el true. I must load faster than my ;; rival who is trying to best me. I must outrace him before he out ;; outrace me. ;; My init.el and myself know that what counts in this struggle is not ;; the lines we write, the showiness of our themes, nor the ;; integrations we make. We know that it is efficiency that counts. ;; Emacs is human, even as I, because it is my life. Thus, I will ;; learn it as a brother. I will learn its syntax, its idioms, its ;; packages, its modes, its keymaps and its defuns. I will ever guard ;; it against the ravages of feature creep and code rot as I will ever ;; guard my legs, my arms, my eyes and my heart against damage. I will ;; keep my init.el clean and ready. We will become part of each other. ;; Before GNU, I swear this creed. My init.el and myself are the ;; defenders of my productivity. We are the masters of our ;; environment. We are the saviors of my life. ;; So be it, until victory is GNU's and there is no other, but emacs!! submitted by /u/Cerebus_2 [link] [comments]

submitted by /u/ahyatt [link] [comments]

Hi, I am setting up `lsp-mode` from scratch, mainly for Python development. I am using `ruff-lsp` and would like to run the "Organize Imports" code action on save. Now, `lsp-execute-code-action` is an interactive function, when called I see a menu of Ruff code actions. But how to call a specific action (e.g. import organizing) non-interactively from Emacs Lisp? I looked at the `lsp-mode.el` source code and apparently, code actions are IDed (!) by hash-maps. So I can do the following: (lsp-execute-code-action #s(hash-table size 4 test equal rehash-size 1.5 rehash-threshold 0.8125 data ("title" "Ruff: Organize Imports" "kind" "source.organizeImports" "diagnostics" [] "data" "file:///home//test.py"))) Which feels super kludgy. Can't be that hard to tie a code-action to a hook, right? So I feel really dumb right now, help is much appreciated. submitted by /u/up_grd [link] [comments]

I upgraded thinking it is going to be better, but apparently not. First off, takes noticeably longer to load compared to earlier versions. No changes to .emacs Just now I tried to comment a whole section of python code using string-rectangle and the results were .... text completely disappeared. It tried the same operation on a smaller number of lines (about 10) and it worked as it should. JSX mode is sloooooow. submitted by /u/BurlyDrink [link] [comments]

submitted by /u/petrzapletal [link] [comments]

Sometime last year I built a small HTTP server and showcased it with version 0.4.2. Mouse is trying to be a lightweight, simple, and easy-to-use HTTP library for Scala. Back when I started it, I found most HTTP libs were very heavy with how many dependencies and features they had, and/or leveraged FP concepts so much that writing basic handlers felt like a big chore. The concept was good, and I wanted to keep building it, but at the time I had chosen Scala 2.13, and I also felt I could have written some of the core logic a bit more nicely. I had thought about picking it back up, and eventually I worked myself up to building it from the ground up in Scala 3. I am now releasing the next version of it, which was entirely rewritten, and has a few of the features that I had promised. Body Streaming support HTTP Client Locking issues fixed Massive performance improvements This is still "early days", and there is still plenty to do, so there will be more posts and more updates to come, so stay tuned. We are one step closer to 1.0. Your feedback and input is appreciated, thanks y'all. :-) GitHub: https://github.com/Aliics/mouse submitted by /u/Aliics [link] [comments]

Jax -> jaxpr -> xla -> JAX is a research project by google that uses python as a “frontend” which it traces to produce a DSL called jaxpr for math. Jaxpr is basically a possibly big pure function. FP is a really good way, at least for me, to quickly write math ideas into code. But when it needs scale, FP approaches are usually not as nice and so you need one of the GPU/TPU accelerator-targeted frameworks (found in python mostly and cpp) I was thinking of doing maybe a Haskell to jaxpr tracing for haskell but I haven’t really made anything big on Haskell yet. I have heard dependent types to haskell before, but havent heard since. Is haskell good at LA notation? An absence of libraries isn’t a problem. I want to make one. I want to do something similar to JAX, which is tracing, and producing a jaxpr. However there are some challenges: - to trace something it has to be evaluated, which i guess is not big of a deal - haskell constructions might lead to “fragmented” computations and not “one big arithmetic” but this might be where i do most of the work What are your thoughts? PS: i know people might not want to use haskell, but personally, i want to use haskell, but I can’t. I tried looking at TF and torch bindings and they look painful to write (compared to python version). submitted by /u/Pristine-Staff-5250 [link] [comments]

Is there in Haskell a way to write a function (or function-like device), F, such that for some inductive type (constructor) Alpha, and another type Beta, F Alpha Beta is the smallest type such that forall value constructors C of Alpha there exists a type constructor C' of F Alpha which takes exactly one argument (which has type Beta) more than C and which has all the parameters of C that have type Alpha replaced by ones with type F Alpha Beta? Basically, I'm trying to write a function that takes an inductive datatype and yields a new type which is just like the old one except that each value has a new little bit of information on every node of the tree which is that value. I have a bunch of different inductive types representing different sorts of expression to be evaluated, and to "evaluate" a term of any of these types I want to tag each node (subexpression) with its value, such that the root node has the value of the whole expression and all the children have their intermediate values. This post is a bit confused, I know, and I'm probably not thinking about the whole thing entirely clearly, so I apologize for any miscommunication. Many thanks to any who answer. submitted by /u/mobotsar [link] [comments]

I have recently started managing a team and I want to monitor their projects and tasks, and also store reviews about the person (like what was their performance on a task or project) to be used for their review. In addition to this, I want to monitor my tasks and projects as well. I have been using a simple system for myself till now, but, I want to get ideas on how I can do so for other people as well. submitted by /u/sudddddd [link] [comments]

Swimming with Ideas This is yet another opportunity to share what you are working on with your friends here on the forum. Add to this discussion by telling us about your zettelkasten journey. Share with us what you’re learning. Sharing helps us clarify our goals and visualize our thinking. And sometimes, a conversation sparks a magical moment where we can dive into an idea worth exploring. I’d love to hear more from you. 🫵🏼 Do you want to do a live video chat with me about our adventures in Zettelkasting? Ping me at @Will, and we can schedule a time. Here is my report on why I’m here and my current ZK work themes and ideas: I spent time working on the transclusion plugin for The Archive. It pulls together notes from a working dynamic outline into a finished document. This is all done i…  ( 4 min )

The pandoc-mode package has been updated to version 20241109.2313.

The hnreader package has been updated to version 20241109.1931.

The cframe package has been updated to version 20241109.1403.

The ujelly-theme package has been updated to version 20241109.1045.

The ob-chatgpt-shell package has been updated to version 20241109.931.

The inputrc-mode package has been updated to version 20241109.10.

So despite warnings to keep the number of entries in org-agenda-files minimal, I've had something like this for about 5 years: (setq org-agenda-files (directory-files-recursively org-directory "\\.org$")) and I'm just now running into issues. Namely that the load of org-agenda takes 30 seconds or so. I'm a heavy org-roam (now org-node) user and so I have about 700 nodes in 'org-agenda-files'. I did this, despite warnings, because it allows me to embed TODOs etc into the Org Roam nodes themselves including the dailies. I find having the TODOs in-context of the node which generated them to be supremely useful. Like I said, this is no longer practical. Does anyone have any recommendations how to keep all of those TODOS in-context but get the org-agenda load back down to < 10 seconds or so? ty submitted by /u/siliconpa [link] [comments]

Hi. I'm developing a documentation generator for Emacs simple packages. It generates Markdown with a information about the package and also documents the exported definitions. Here is an example of the generated documentation for a package. The generator is available from here for now .. It is work in progress, but I think it is useful and I'm already using it for some of my projects. Hope you find it useful too. submitted by /u/mmontone [link] [comments]

I made a small-ish experiment yesterday and today. Nothing special but slightly less parenthesis in let and some forms that use let, for example: (lex-while (x 10 run t) (setq x (1- x)) (when (< x 5) (setq run nil))) submitted by /u/arthurno1 [link] [comments]

"...it's a complete lisp interpreter which can be used to run all sorts of functions and programs that you probably run." I say this to people all the time, and get some confused looks. So I've been compiling a list of examples of said program types or functionalities, which might not be considered core text editor territory. There are the obvious ones of course, like magit and org (and the many, many different uses org can be put to could be a thread on its own...), and textfile manipulation that a nano or vi user might do separately on the command line like grep, programming related activities like compiling and debugging, but also less obvious things like exwm, emms, and erc. Do you have any other favourites? And how does having them in one integrated ecosystem help you be more efficient, bring joy to your computing life, etc? Edit: perhaps I didn't make myself clear. Yes I know it's an editor, it's my favourite editor. It has been the only editor I willingly use for several years and I expect it to remain so for the rest of my life. I'm simply trying to find an engaging way to answer people's queries about it. submitted by /u/gnudoc [link] [comments]

submitted by /u/Potential_Tree_8013 [link] [comments]

My first package, I'm actually happy. I usually craft some functions on my side to ease my emacs life but I decided to make a package out of this one. You can find it here: https://github.com/mattiasdrp/pokemacs-layout Basically, it allows you to define your own window layout and load it whenever you want (I use it because I have a wide screen and my emacs setup is composed of multiple windows that always have the same layout but not the same content and desktop-save didn't help me for this kind of thing) My emacs-fu is not optimal (far from it, I find myself adding some quotes randomly when things don't work the way I want), if you have any remark about my code I'll take it with great pleasure! submitted by /u/MonsieurPi [link] [comments]

Hello, I found this video course : https://www.youtube.com/watch?v=nlTJU8wLo7E is this a good one to learn Haskell submitted by /u/roelofwobben [link] [comments]

https://preview.redd.it/6rl7pln5cwzd1.jpg?width=850&format=pjpg&auto=webp&s=aca8887001162405150a1f9c0918b41895d632ee https://preview.redd.it/gbdebdp6cwzd1.jpg?width=850&format=pjpg&auto=webp&s=d2a7fcc6696b6e18d4d3c49086e012917e89b5cf These errors appeared while downloading the packages (mingw32.db, mingw64.db, ucrt64.db, clang32.db, clang64.db). I am trying to install Haskell using the GHCup site (https://www.haskell.org/ghcup/), but I always get these two error messages below. I am new to computer science and not sure what to do. submitted by /u/AnaTheCreep [link] [comments]

Hello haskellers! I want to share this small project I've been working on. It is a starter login page made with servant, lucid, postgresql-simple and semantic-ui. It has a service for OTP also! (Using telnyx api). I hope this can help someone out. It is heavily based on hastl so thanks for sharing that, and Matt Parsons amazing book. PS. I want to apologize for lack of error management, that's something I hope to add on the future, but was on a rush. Any questions, suggestions, and/or improvements are more than welcome. submitted by /u/AdOdd5690 [link] [comments]

For some reason my projects don't show up in the recent projects section on the emacs-dashboard, even if I open and edit files in the project. Is there anything I have to do to make my projects show up? Thanks! Here is my projectile/dashboard config: (projectile-mode +1) (define-key projectile-mode-map (kbd "C-c p") 'projectile-command-map) (setq projectile-project-search-path '("~/Code/" "~/org-brain-v2/")) (setq dashboard-icon-type 'all-the-icons) (setq dashboard-set-heading-icons t) (setq dashboard-set-file-icons t) submitted by /u/WeezeAlarm [link] [comments]

I may get flak for this but I’ll ask anyway….. How can I map left control to: Copy C-c Paste C-v Undo C-z Redo C-x While preserving the default emacs keybinds to right control? (I’m on windows btw) submitted by /u/adw__ [link] [comments]

submitted by /u/edorhas [link] [comments]

I found that exporting documents to Latex PDF from Emacs in orgmode is not conveniently documented when it comes to including code blocks using the listings package. See for instance some posts e.g. this one. To sort that out I followed the following tip. (Of course after 1. set t org-latex-listings, 2. set your style with \lstdefinestyle{mystyle}{..options}, and 3. input the whole settings.tex file into your main orgmode document with the diretive #+LATEX_HEADER: \input{path-to-your-settings.tex}). I notice that the org-latex-listing-commands injects a pair k=v to the list of parameters for the listing package to execute when exporting, so I did it for the key "style=mystyle" and some important ones (2) that by unkown reasons get ignored whatever you do, and for explicity I added (again) the mystyle value as seen below, and it works, now. I did a (little more detailed) post explaining this ~~. racket (setq org-latex-listings 't) (setq org-latex-listings-options '(("language" "Python") ("style" "mystyle") ("numbers" "left") ("numberstyle" "\\tiny\\color{gray}"))) ` A screenshot here submitted by /u/xeyenn [link] [comments]

submitted by /u/jamescherti [link] [comments]

How can I compile all packages to native code (to eln). I know that packages are compiled to elc by default, but as I built emacs with native compilation support, I want to utilize this feature. I am not using any package manager (like straight.el). This is what I am using currently... ```lisp (require 'package) (setq package-archives '( ("melpa" . "https://melpa.org/packages/") ("elpa" . "https://elpa.gnu.org/packages/") )) (package-initialize) (unless package-archive-contents (package-refresh-contents)) (unless (package-installed-p 'use-package) (package-install 'use-package)) (require 'use-package) (setq use-package-always-ensure t) ``` submitted by /u/Rid1_fz_06 [link] [comments]

I'm using Emacs with eglot and corfu for Go development, and I'm trying to set up struct field autocompletion. Specifically, I want to achieve the following behavior: Given this Go code: package main type Person struct { Name string Address string Age int } func main() { p1 := Person| // cursor position marked with | } When I press TAB, I want it to autocomplete the struct initialization with all fields, something like: p1 := Person{ Name: "", Address: "", Age: 0, } Current Setup: Emacs 29.1 eglot for LSP corfu for completion UI gopls as the Go language server In go-mode I use this function to test some options: (defun my-test-eglot-config (config) "Test different eglot configurations." (interactive) (when (eglot-managed-p) (eglot-shutdown-all)) (pcase config ('default (se…

submitted by /u/ActiveDark2732 [link] [comments]

I'm running emacs 29.3 on ubuntu 24.04. I've been trying to install several versions of .emacs.d/init.el. One problem is common to all of them: Code: Done previously: cd .emacs.d; mkdir themes; M-x package-install RET ubuntu-themes RET Installed into .emacs.d/elpa/ubuntu-theme-20150805.1506, then copied ubuntu-theme-20150805.1506 into .emacs.d/themes (add-to-list 'custom-theme-load-path "~/.emacs.d/themes") (load-theme 'ubuntu-theme) When I enter C-x C-e Debugger entered--Lisp error: (error "Unable to find theme file for ‘ubuntu-theme’") error("Unable to find theme file for `%s'" ubuntu-theme) load-theme(ubuntu-theme) (progn (load-theme 'ubuntu-theme)) elisp--eval-last-sexp(nil) eval-last-sexp(nil) funcall-interactively(eval-last-sexp nil) command-execute(eval-last-sexp) I did this successfully six month ago, and later had a hard drive crash. I can't remember exactly what I did then, but I was successful, and I really like the aubergine background and the colors for syntax. Can anyone see what I'm doing wrong?I'm running emacs 29.3 on ubuntu 24.04. I've been trying to install several versions of .emacs.d/init.el. One problem is common to all of them: Code: submitted by /u/GothRoger [link] [comments]

I just made a small little wrap around let* to reduce number parenthesis. I understand how to make the body of my new form to align as I would like it, but not sure how to make the declaration list align. I am looking at setf and & co in the sources, but I don't see where they have declared it. Does anyone know what/where to declare? (defmacro lex (pairs &rest body) (declare (indent defun)) (if (/= (logand (length pairs) 1) 0) (signal 'wrong-number-of-arguments (list 'lex (length pairs)))) (let ((args)) (while pairs (push (list (pop pairs) (pop pairs)) args)) `(let* ,(nreverse args) ,@body))) (lex (x 1 y 2 <-- how do I align 2nd and 3rd line with the first? z nil) (message "%s %s %s " x y z)) submitted by /u/arthurno1 [link] [comments]

``` cabal-version: 3.0 name: cabalTest version: 0.1.0.0 common warnings ghc-options: -Wall library import: warnings other-modules: Risk -- LANGUAGE extensions used by modules in this package. -- other-extensions: build-depends: base ^>=4.20.0.0, MonadRandom hs-source-dirs: . default-language: Haskell2010 ~/cabalTest ❯ ls dist-newstyle cabalProba.cabal Risk.hs ``` submitted by /u/Esnos24 [link] [comments]

submitted by /u/peterb12 [link] [comments]

I am fairly decent in Haskell syntax I am thinking to read Effective Haskell Any other books ? My aim is to learn functional programming designs, how to use Haskell in real world and craft my skills for abstractions Please suggest some high quality resources submitted by /u/kichiDsimp [link] [comments]

Can Perceus reference counting be used in GHC instead of garbage collector? submitted by /u/leonadav [link] [comments]

Hello! Are there performance advantages of using RWS monad versus just State monad? Let's take lexer / parser engine for example: - i have source code which is not mutable, so it's going to reader part of RWS - error logs - writer part of RWS - position of lexer / list of tokens - state part of RWS All this looks pretty logical. But i can do all the same in State, where i keep source code and log in the state itself, i can even wrap modify / gets into tell / ask so code will be the same :-) Which one is better? submitted by /u/Tempus_Nemini [link] [comments]

The igist package has been updated to version 20241108.1947.

The org-tag-beautify package has been updated to version 20241108.831.

Problem: Sub-quadratic decreasing of throughput when length of the JSON number to parse is increasing On contemporary CPUs parsing of such JSON numbers that are decoded as BigDecimal and has 1000000 decimal digits (~1Mb) can took more than 10 seconds Below are results of the benchmark where the size parameter is a number of digits to parse and decode: - circe + original parser - circe + jawn parser Now it is tested separately for JSON numbers and strings because the standard decoder is lenient and is able to parse and decode stringified numbers Also, both successful and failure cases (number overflow for whole primitives) are tested too Tested by scala-cli with --power option using JDK 21 on Intel® Core™ i7-11800H CPU @ 2.3GHz (max 4.6GHz) Workaround 1: Limit number of bytes for parsed and decoded messages for all JSON inputs that can come from un-trusted/malicious counterparts Workaround 2: Use jsoniter-scala-circe's parser and decoders for numbers that should be imported after original ones in the implicit scope of decoding and then as a bonus you will get 20-30% speed up for numeric and 2x-4x speed up for stringified representations of numbers submitted by /u/plokhotnyuk [link] [comments]

submitted by /u/fwbrasil [link] [comments]

Question for beorg users. Did there used to be a way of making a single payment to gain lifetime access to all extensions? I could have sworn that at one point I made a payment that avoided having to remember to renew a monthly or annual subscription. But I just revisited the app (after a > 1 year pause in use) and I don't have any extensions, and pressing "Restore Purchases" doesn't restore anything. It's entirely possible that I'm misremembering, and that the "all-ness" of that past payment was that it gave access to all extensions, but not for all time, but my recollection is definitely otherwise and that it provided both. I just thought I'd check with you guys first, before I send off a Disgusted-of-Tunbridge-Wells-style complaint email to beorg support. 🙂 submitted by /u/TeeMcBee [link] [comments]

The consult-eglot-embark package has been updated to version 20241107.2125.

The consult-eglot package has been updated to version 20241107.2125.

The projection-multi-embark package has been updated to version 20241107.2107.

The projection-multi package has been updated to version 20241107.2107.

The projection-dape package has been updated to version 20241107.2107.

The telega package has been updated to version 20241107.1559.

The tempel-collection package has been updated to version 20241107.1417.

The webpaste package has been updated to version 20241107.1037.

The evil-matchit package has been updated to version 20241107.843.

The ws-butler package has been updated to version 20241107.519.

The flycheck-phpstan package has been updated to version 20241107.408.

The org-ql package has been updated to version 20241107.345.

The d2-mode package has been updated to version 20241107.236.

I'm 40 hours into Learning Haskell through LearnYouAHaskell (paired with ChatGPT) and am no where near the point of being capable of building something truly functional. I can solve some of the Haskell problems on Exercism and am starting to understand the syntax, but it still feels so far away. I understand Haskell has one of the highest learning curves for functional programming, but did everyone here go through this same learning curve? submitted by /u/BaxiaMashia [link] [comments]

submitted by /u/ludat [link] [comments]

I need some advice / feedback for the next version of Hyperbole. The new version will have typed handlers: the compiler will guarantee the page knows how to handle any HyperViews you use. This complicates the interface a little. I have a couple of options for the new interface, but one solution requires UndecideableInstances and I'm unsure if it's a good idea. The Old Interface In the first release: a page for the infamous counter looks like this: page :: (Hyperbole :> es, Concurrent :> es) => TVar Int -> Page es Response page var = do handle (counter var) load $ do n <- readTVarIO var pure $ col (pad 20 . gap 10) $ do el h1 "Counter" hyper Counter (viewCount n) data Counter = Counter deriving (Generic, ViewId) data Count = Increment | Decrement deriving (Generic, ViewAction) instance H…

A new release of SBV (v11.0) is out: https://hackage.haskell.org/package/sbv What's new in this version is a new layer of theorem-proving API, called KnuckleDragger, which allows for calculational and inductive proofs directly in SBV. While SMT-solvers don't do induction out-of-the box, KnuckleDragger allows injection of inductive schemas to make inductive reasoning possible. It also provides a way of expressing calculation-style equational proofs. For instance, a proof of reverse-append (reverse (xs ++ ys) == reverse ys ++ reverse xs) or reverse-reverse (reverse (reverse xs) = xs) can now be directly encoded in SBV. (The proofs are done only for finite lists, to be precise.) See: https://hackage.haskell.org/package/sbv-11.0/docs/Documentation-SBV-Examples-KnuckleDragger-AppendRev.html …

what program and command line does hls running? how can I get more information? here is the output from haskell-language-server-wrapper output. Step 3/4: Initializing the IDE Step 4/4: Type checking the files 2024-11-07T07:51:20.347794Z | Info | Cradle path: test1/test/Spec.hs 2024-11-07T07:51:20.347871Z | Warning | No [cradle](https://github.com/mpickering/hie-bios#hie-bios) found for test1/test/Spec.hs. Proceeding with [implicit cradle](https://hackage.haskell.org/package/implicit-hie). You should ignore this message, unless you see a 'Multi Cradle: No prefixes matched' error. 2024-11-07T07:51:20.348945Z | Info | invoking build tool to determine build flags (this may take some time depending on the cache) 2024-11-07T07:51:20.349582Z | Info | stack --stack-yaml /home/deng/Projects/hs/s…

I purchased the Archive and have downloaded in multiple browsers but it never opens/launches. I can’t find anywhere that there is support for the app. Can anyone here help me? Thanks!!  ( 2 min )

I've had this problem sometimes with other languages. I think it happened to me a couple of times with C++. It seems silly to me that Emacs has problems locating the file when the file itself is already loaded in the buffer in most cases! And even if it's not, it still should not have this problem. How can I fix this? It must be some sort of ambiguous path issue, I would guess. submitted by /u/el_toro_2022 [link] [comments]

submitted by /u/SaraBiYo [link] [comments]

while I've tried dap mode using go, its been a pain. I've launched a configuration, but when continuing over a break point its window p is null. I've also tried" Go Dlv Attach Configuration" with eshell but I want it to use port 8080 instead of port 49755 I need a guide on how to use it submitted by /u/SolidBric [link] [comments]

(defvar qwe 3) (setq qwe 1) (defun my-print-qwe () “” (message “inner: qwe = %d” qwe)) (let ((qwe 2)) (message “let: qwe = %d” qwe) (my-print-qwe)) ;; Lexical binding has always been enabled. When I place the cursor at the end of the second line and press C-x C-e, then press C-x C-e again to execute the following two statements (completely ignoring defvar), why does it still output "inner: qwe = 2"? However, if I comment out the first line at the beginning and keep the rest of the operations unchanged, the output is as expected: "inner: qwe = 1"? submitted by /u/ilygre [link] [comments]

I was wondering is there anything similar to this, but that have more generic implementation and that supports outer mode (vim 'a' feature) ? (defun treesit-delete-inside-brackets (bracket-types) "Delete everything inside the nearest specified BRACKET-TYPES using Tree-sitter. BRACKET-TYPES should be a list of node types for the targeted brackets, e.g., '(\"parenthesized_expression\" \"argument_list\") for parentheses, '(\"array\" \"list\") for square brackets, or '(\"block\" \"braced_expression\") for curly braces." (interactive) (let* ((node (treesit-node-at (point))) (bracket-node (treesit-parent-until node (lambda (n) (member (treesit-node-type n) bracket-types))))) (if bracket-node (let ((start (1+ (treesit-node-start bracket-node))) (end (1- (treesit-node-end bracket-node)))) (delet…

This morning the company that I work for is rolling out a new central software store. On December 1 they’re planning on basically scanning everyone’s machines and removing all not approved software. Naturally, I wanted to check the approval list to see if Emacs was on it. As I figured, it wasn’t. The funny thing to me is the description for Emacs says: “An old fashioned and slow text editor created by Canonical for use with the Ubuntu operating system”. Now, there’s many layers to this statement and why it’s funny. But, my main issue is that it shows clearly whoever is making decisions about approved software really knows nothing about it. The only three currently approved editors in the system are Neovim, VSCode, and Visual Studio. Also as a side note, Vim is restricted and the description for it is: “Developed by CentOS, an editor with a steep learning curve”. This just further proves my point that the people making these decisions know nothing about the software that they’re talking about. In a way it’s disrespectful to the original creators who worked hard on a project that they were passionate about, only to not receive the credit they deserve by everyone. submitted by /u/LegO_Grievous__ [link] [comments]

I saw reports a while back that Emacs didn't work well on MacOS Sequoia mainly due to issues with the path. IIUC exec-path-from-shell soves these. Whoever has upgraded: any other issues that would advise to wait? TIA! submitted by /u/mst1712 [link] [comments]

M-x praise-emacs! Summary Because of doing a lot of git operations, I have to answer changed on disk; really edit the buffer? (y, n, r or C-h) prompts all the time, but 90% of the time, the actual file contents are the same. How to get around this? Details These days, I am spending a lot of my time editing files in Tramp mode on a remote server, which is beefy but sees heavy use too. I had to turn off git-gutter to make it work - that would keep hanging saves! - but it's generally worked really well. That's not a big deal, except for one nasty side effect: almost always when I go to edit a file, I get a message like this: test_set_linter.py changed on disk; really edit the buffer? (y, n, r or C-h), because I've done some git stuff or other and changed (I believe) the modification date of the file. Thing is, 95% of the time, the actual contents are byte-for-byte the same, so this message is useless to me. Is there a way to prevent that prompt from popping up if the file contents are the same? I couldn't get autoreload auto-revert to work on Tramp for some reason, but I wasn't very enthusiastic about the idea anyway because if I have a lot of files being edited, I'll be reloading dozens or hundreds of fairly large files every time I switch branches, which is a lot. Thanks in advance! submitted by /u/HommeMusical [link] [comments]

What are your Emacs bad habits? I have several. Most of them I think I know the actual good practice, the ones that pop most often are: Using C-x b RET instead of C-x LEFT to go to the previous buffer Using regular switch buffer instead of project switch buffer Forgetting I set up repeat mode C-a instead of M-m and now I got to C-f*n or M-f M-b goddamit. That window could have been closed an hour ago but it's still there Forget to save window configurations in registers (python related, especially painful with git worktrees) Why did I not make sure I was using the right venv with pyvenv? submitted by /u/pizzatorque [link] [comments]

I just moved my email server to a VPS. I can no longer send email with Emacs. Receiving emails is fine. Thunderbird can send mails with the same settings. (setq smtpmail-smtp-server "mail.domain.tld" smtpmail-smtp-service 465 smtpmail-stream-type 'ssl smtpmail-smtp-user "peter@domain.net" message-send-mail-function 'smtpmail-send-it user-mail-address "peter@domain.tld") I tested these with unfigured Emacs. Result: smtpmail-send-it: Sending failed: 550-Rejected because 123.***.***.*** is in a black list at zen.spamhaus.org Where 123... is the IP address of my internet connection. So not the IP address of my mail server. What am I missing? submitted by /u/danderzei [link] [comments]

I just received a palma 2 and installed android Emacs on it. When I drag, the screen has no response until I switch to task manager (or change refresh mode) and back to the app. Anyone can help me? By the way, Boox Tab 10C no this issue. I posted a video here: https://www.reddit.com/r/Onyx_Boox/s/KZZyXLFZrl submitted by /u/DR_MING [link] [comments]

I need to do what I think are 2 very simple things: Reload my snippets Open eshell with the project root as the directory rather than the current buffer's directory I've been searching for a solution for hours. I tried `yas-recompile-all`, `yas-reload-all`, and I restarted Emacs also. A snippet I deleted is still there. This is making me so frustrated. The whole point of using snippets is so I can save time, and instead I end up wasting a whole day having accomplished nothing. Then there's eshell. Every time I open eshell, it goes to th e buffer's directory. Even typing cd ../.. is such a pain when the completion system keeps interfering with it and I can't type it properly without hitting escape each time I move up one directory level. I could not find a solution for this anywhere. I find it hard to believe that I'm the first one who needs to do this. This is not the first time I've faced issues. I've posted on forums about other issues and it did not get a single reply even after 3 weeks. I know there are books and tutorials and videos about all kinds of things, I get it. But really, just to enable one small setting so I can get going, I have to spend months? submitted by /u/surveypoodle [link] [comments]

This misbehavior is on orgmode version 9.7.12, Emacs 29.4 For some files applying a tag or fold/expansion action at a heading results in this action applied at the parent heading. When this happens I see the cursor move to the parent heading. Unfortunately I cannot share screenshots because the files are personal or confidential. But for example applying a tag (org-set-tag) moves the cursor to the parent heading and the tag is applied there. Pressing tab will fold the parent node. Before submitting a bug report I wanted to see whether anyone else seen this behavior. Thanks, submitted by /u/mirkov19 [link] [comments]

Welcome to another issue of Haskell Weekly! Haskell is a safe, purely functional programming language with a fast, concurrent runtime. This is a weekly summary of what’s going on in its community. Featured Competitive Programming in Haskell: Union-Find by Brent Yorgey My implementation is based on one by Kwang Yul Seo, but I have modified it quite a bit. The code is also available in my comprog-hs repository. This blog post is not intended to be a comprehensive union-find tutorial, but I will explain some things as we go. Debugging Haskell Type Errors by Tikhon Jelvis Fixing Haskell type errors can be hard. Learning how to understand and fix type errors was the first real obstacle I faced when I first picked up the language. I’ve seen the same tendency with every Haskell beginner I’ve taug…  ( 2 min )

submitted by /u/lihaoyi [link] [comments]

Hello everyone! I'm currently learning ZIO through the Rock the JVM course (which, by the way, is fantastic!). I've been diving into the world of ZIO, and I had the following thought. Using ZIO (and likely Cats Effect as well) almost feels like working with a different language on top of Scala. Everything revolves around ZIO monads. The error handling is also done using ZIO. While that’s fine and interesting, it got me wondering: Doesn't this level of dependence on a library create too much coupling? Especially how divided the community is between cats vs ZIO I know I called ZIO a "library," but honestly, it feels more like a superset or an extension of Scala itself, almost like TypeScript is to JavaScript. It almost feels like a different language. I know I'm going a bit too far with this comparison with TypeScript but I'm sure you will understand what I mean. Hopefully it will not trigger too much people in this community. What are your thoughts? Feel free to share if you think my concern is valid? I would love to hear what you guys think. Thanks, and have a great day! submitted by /u/yinshangyi [link] [comments]

Effect is a powerful library for TypeScript developers that brings functional programming techniques into managing effects and errors. It aims to be a comprehensive utility library for TypeScript, offering a range of tools that could potentially replace specialized libraries like Lodash, Zod, Immer, or RxJS. In this blog post, we will introduce you to Effect by creating a simple weather widget app. This app will allow users to search for weather information by city name, making it a good example as it involves API data fetching, user input handling, and error management. We will implement this project in both vanilla TypeScript and using Effect to demonstrate the advantages Effect brings in terms of code readability and maintainability. What is Effect? Effect promises to improve TypeScrip…  ( 17 min )

An earlier post about C-g got me thinking (dangerous). It's such a long reach on the keyboard with one hand for one of the most often used keybindings in emacs. If ever there were a candidate for re-mapping it's this. Maybe swap with C-q which is mnemonic for 'quit' - and I already have plain old 'q' to quit from magit, buffer-menu, dired, elfeed and poppler buffers. C-q is presently quoted-insert, a very short reach for such a rarely used keybind. And even more so for C-y and M-y - but what to substitute? It's just a matter of time until my 40-year emacs-finger-memory and inertia is defeated by my increasing arthritis and desire to tweak. A simplistic ... (global-set-key (kbd "C-q") 'keyboard-quit) (global-set-key (kbd "C-g") 'quoted-insert) ... is insufficient as there are other 'hidden' mappings of C-g such as in C-s isearch-forward where it is mapped to isearch-abort. Others? On the other hand, was it a conscious design decision to promote a pause for thought by making these keybinds so awkward? No - it could not be, otherwise C-w kill-region would be less convenient. Much as I would like to stray as little as possible from canonical keybinds, I already mapped C-z to undo several years ago as it's just so useful and habitual and the default keybinding is so useless in a GUI. Thoughts? submitted by /u/StrangeAstronomer [link] [comments]

Is just a genuine question that I have about how do "internet guys" learn anything that they want to, e.g., I have watched youtube videos to learn programming to an extent, or the official documentation in the case of emacs, wby? submitted by /u/Kiiwyy [link] [comments]

TL;DR: Filenames are not case sensitive in APFS, the default MacOS filesystem. This causes problems for straight's smartparens repo ("latex" vs "LaTeX") This leads to more problems. I fixed the issue by putting .emacs.d/straight on a new case-sensitive FS volume. So, I use straight in init.el to manage my packages. One of my packages is smartparens. Whenever I try to update my smartparens version with straight I see this: Repository "smartparens" has a dirty worktree: M test/smartparens-LaTeX-test.el z Stash changes d Discard changes [...etc...] I can't make progress by using d Discard changes. I looked at the repo under .emacs.d/straight/repos/smartparens. First, there are indeed diffs in test/smartparens-LaTeX-test.el: $ cd .emacs.d/straight/repos/smartparens $ git diff i…

Is there a way to set a fallback when eglot times out? There's the ordered list of backends for Company, but when the lsp timeout happens, it seems to interrupt things. What I'd prefer is to fall back to a dumb text completion that is close/has been used recently. Also, with eglot, is there a way to set it so if xref-find-definition fails, it falls back to xref-find-apropos? submitted by /u/vjgoh [link] [comments]

Just trying to make remembering the shortcuts easier. submitted by /u/THhhaway [link] [comments]

https://blog.aheymans.xyz/post/llm_in_emacs/ LLMs are an interesting piece of technology to play with and emacs is my favorite way to interact with them. submitted by /u/avph [link] [comments]

Some context first: I switched from vim to emacs about a year ago. I just need something that works and I figure I could learn as I go along, so I set up Doom Emacs and went to work right away, and I've kept at it. I do all my editing in emacs. Can't say I know all the keyboard tricks like some of you wizards, but hey at least I can get my work done, and that's good enough for me. Now recently, I was working in a project. I don't know what I pressed, but the contents of my buffer disappeared. Just undo it, right? NOPE. When I pressed u to undo, nothing happened. The file got overwritten with a blank file. It was GONE. Definitely a skill issue, and I have absolutely no idea what just happened. Lucky for me, the file just had a small function and I was able to rewrite it, but now it's triggering my anxiety about what if it happens again. I don't even know how or what happened. So now, this has me thinking, what's the worst thing I can do in Emacs? submitted by /u/floofcode [link] [comments]

At the moment I'm not able to install sth. using melpa.org:443 Anyone else? Website also seems to be down. submitted by /u/RepresentativeFox684 [link] [comments]

submitted by /u/MethAddictedMonkey [link] [comments]

This is a thread for smaller, miscellaneous items that might not warrant a full post on their own. See this search for previous "Weekly Tips, Tricks, &c." Threads. Don't feel constrained in regards to what you post, just keep your post vaguely, generally on the topic of emacs. submitted by /u/AutoModerator [link] [comments]

submitted by /u/tioulims [link] [comments]

The ess package has been updated to version 20241106.2028.

The timu-line package has been updated to version 20241106.1906.

The list-utils package has been updated to version 20241106.1849.

The uniline package has been updated to version 20241106.1525.

The ibuffer-vc package has been updated to version 20241106.1518.

The cmake-mode package has been updated to version 20241106.1341.

The matlab-mode package has been updated to version 20241106.1204.

The pet package has been updated to version 20241106.1133.

The dwim-shell-command package has been updated to version 20241106.942.

The copilot-chat package has been updated to version 20241106.816.

The sis package has been updated to version 20241106.755.

The markdown-mode package has been updated to version 20241106.602.

https://github.com/getkyo/kyo/releases/tag/v0.14.0 New Features kyo-data Text: Optimized API for string manipulation that avoids copying the underlying char array. Schedule: A new data type for representing complex scheduling. kyo-prelude Parse Effect: New effect with support for backtracking, lookahead, and cut operations. The Parse effect is implemented using Var to track parsing position and Choice to evaluate multiple possible branches. The API is designed to provide a more intuitive experience by using an imperative-like approach for consuming inputs and evaluating alternatives, rather than composing parsers with special operators. The effect also supports incremental parsing through integration with Stream in Parse.run. kyo-core Unsafe Queue and Channel: New protect…

submitted by /u/julien-truffaut [link] [comments]

I'm currently starting a hobby project that will require a mobile application and a backend. The backend will obviously be written in Scala, but I'm unsure about the mobile part. Given that this is a project for a single developer and that I don't want to maintain two native applications, I'm evaluating the different frameworks that would allow me to create a mobile application with a single codebase: Flutter, React Native, Kotlin Multiplatform, have I missed one? I'm curious to hear from people who develop a Scala backend serving a mobile application: do you have a recommendation? Do any of these frameworks provide an advantage when « coupled » with a Scala backend? I'd like to take advantage of either Tapir or Smithy4s to manage API contracts and generate payload models for the frontend language. Does one of these frameworks allow to easily automate this and has good synergy with Scala ? submitted by /u/Tactical-Astronaut [link] [comments]

Here is what i did: curl --proto '=https' --tlsv1.2 -sSf https://get-ghcup.haskell.org | sh restarted my laptop typed : ghc and zsh says there is no command called ghc again ran install command and this time https://preview.redd.it/2au71ojj5bzd1.png?width=1256&format=png&auto=webp&s=f500edc60d99906592270dada73b045675ba718d Help, I really wanna get into haskell SOLVED Solution: put this in my .zshrc [ -f "$HOME/.ghcup/env" ] && . "$HOME/.ghcup/env"[ -f "$HOME/.ghcup/env" ] && . "$HOME/.ghcup/env" submitted by /u/EVdeath_god [link] [comments]

submitted by /u/kosmikus [link] [comments]

Hi all, I am preparing my bachelor thesis and since my major is cybersecurity, my advisor told me the topic must be related to it. I like haskell, so I want to implement something with haskell . Do you haskellers have any suggestions? submitted by /u/defmeritamen [link] [comments]

khalel: Interacting through Emacs with locally-stored calendars via the console application khal and syncing with remote CalDAV calendars using vdirsyncer. Khalel or Vdirsyncer seems to give me ugly calendar names in the Emacs Agenda. Instead of :oSbEHYQnaQXnVqWxZta6iZ7kUYvWNvYl: I want Agenda to display Etesync. Instead of :[abded12345@group.calendar.google.com](mailto:abded12345@group.calendar.google.com): or :[user@gmail.com](mailto:user@gmail.com): I want Agenda to display Google. How can I do this with Khalel? Or is this a Vdirsyncer and Khal issue? ``` Week-agenda (W45): Monday 4 November 2024 W45 Tuesday 5 November 2024 calendar: 22:00-23:00 Test Etesync :oSbEHYQnaQXnVqWxZta6iZ7kUYvWNvYl: calendar: 23:00 ┄┄┄┄┄ (1/2): Test :[abded12345@group.calendar.google.com](mailto:abded12345@group.calendar.google.com): Wednesday 6 November 2024 calendar: 0:00 ┄┄┄┄┄ (2/2): Test :[abded12345@group.calendar.google.com](mailto:abded12345@group.calendar.google.com): ``` submitted by /u/MethAddictedMonkey [link] [comments]

Was able to finally get it going and generate native code. The results are mind boggling. I have a very memory intensive personal project that used to max out all the available memory and now takes only a few %. The speed is also roughly 10x. Anyone else can provide some feedback on their personal experience too? As such Graal isn't Scala centric and there are issues regarding built in reflections inside the 3.x scala libs. Nonetheless if one doesn't use them and forces the generation of native code it works out fine BUT it would be nice if moving forward the Scala language influencers would keep the ability to easily generate native code from Scala as a major goal to keep the language not only relevant but also offer industrial grade performance and even real time embedded code possibilities. scala-native is of course a sub project but it doesn't offer the scope of possibilities merely taking an assembly jar and generating machine code. For the record not only Graal works for me on my laptop but also on an AWS EC2 instance where I copy the jar and then execute native-image. There in the cloud the extra performance means $$$ as a lesser instance offers the performance of one at least 2 units larger and that more costly. My medium EC2 for example now runs way faster and again only a few % of the memory there is used. Before everything would blow up sometimes with a OutOfMemory exception no matter the memory I would cap the java VM at... submitted by /u/totalialogika [link] [comments]

I've been working with Scala for almost 2 years in backend development, but I'm currently underpaid and looking to move into a better role at a top company. I’ve started prepping for interviews and am wondering how best to approach coding questions in Scala. For Scala roles at top companies, are interviews typically DSA-focused, or do they emphasize Scala-specific and functional programming concepts? I’m currently reading the "red book" and considering the "Scala & Functional Programming Interview Practice" course from Rock the JVM. Should I also be practicing standard imperative solutions on LeetCode with Python/Java? Any thoughts on what the best language to use in my situation would be? submitted by /u/Separate_Memory8229 [link] [comments]

Hello. Just a preface, I am not a programmer & I have ~1 year of using org-mode. Like many of you I absolutely love org-mode, & use it as i'm working on songwriting & my daily to-do list. I've kind of learned on my own watching tutorials here & there.. but now I really want some ideas from other users on some specific questions that I have: -- Thanks for your time in advance. So, what's the best way to organize your files on Windows? Everything is saved in the appdata folder & everytime I try to move it to a folder on my desktop, it automatically creates another Emacs folder in my appdata folder along with a .emacs.d file & this repeats every time I've tried to fix it. Should I just save everything in that appdata folder? I would also kinda like to save my desktop files with my phone & laptop.. but i've just resorted to emailing them to myself, which isn't the best option. I'd love to learn from the community here! submitted by /u/jacopito [link] [comments]

I'm currently using org-roam for note taking, dailies, experimenting with agenda , and really enjoying it. I recently bought a car, and was thinking of using org-mode to kind of track maintenance on it. Then it occurred to me, that maybe a good use of org's "tangle" feature might be to enter maintenance stuff into my daily journal, and then "tangle" that info into a file dedicated to that specific car. So I'd have an org file called "2024RedFerarri" (totally my real car), and it'd be at least partially composed of sections tangled from my roam dailies. It's possible that this would work but might be kind of impractical, or maybe I'm fundamentally misunderstanding "tangling". Does r/emacs think this is a good use of this feature? submitted by /u/mlsfit138 [link] [comments]

Is it not suggested to use Emacs on Windows 11? I'm just interested in the text editor, and I'm learning C++. Can I hook it up to the MSVC compiler, or use another compiler like Mingw-w64 to run and compile c++ code? Thank you. submitted by /u/One-Material-9466 [link] [comments]

I use emacs for To-Do list, some note taking but not for notes of classes or projects, do you? submitted by /u/Kiiwyy [link] [comments]

submitted by /u/LionyxML [link] [comments]

Hey there, No, I don't want to use Doom. Is there anyone's config I can steal for Typescript projects that just work using Emacs that compares to the out of the box experience of VSCode? Anyone else feel frustrated by trying to configure LSP for the 20th time on Linux or MacOS only to get half assed indentation or things that just work with IDEs? Thanks! submitted by /u/BackToPlebbit69 [link] [comments]

The osm package has been updated to version 20241105.2132.

The jinx package has been updated to version 20241105.2132.

The vertico package has been updated to version 20241105.2131.

The company package has been updated to version 20241105.1709.

The pr-review package has been updated to version 20241105.1542.

The cape package has been updated to version 20241105.858.

Anduril Industries is hiring Haskell engineering interns for summer 2025 to work on electromagnetic warfare products. This is a unique opportunity to use Haskell to implement high performance applications in an embedded setting. Anduril has adopted Nix at large and we use IOG's generously maintained Haskell.nix project to build all of our Haskell code and ship it to thousands of customer assets across the globe. If you have Haskell experience and are interested in any of: Software defined radios Digital signal processing Numerical computing FPGAs Linux drivers/systems programming Nix/Nixpkgs/NixOS Dhall please do drop me a line at [travis@anduril.com](mailto:travis@anduril.com), and please also submit your application to our online portal here: https://programmable.computer/anduril-intern-job.html I'd be happy to answer any other questions in the thread below. submitted by /u/TravisMWhitaker [link] [comments]

I am taking a course on functional programming at my university where we are learning haskell. I am using neovim. I am wondering if there is a way i can get the type definition that the hls shows to the right of the function as shown on the picture here: https://preview.redd.it/yfijs4l4u2zd1.png?width=1344&format=png&auto=webp&s=59415d82ba01059368a2c57db2c899058f10b5d1 Could be moved to be above the function instead. So i can actually read the type? Or is there a command i can bind to show the type? Maybe something that shows the type like: vim.diagnostic.open_float shows the diagnostics? submitted by /u/pete372b [link] [comments]

I've just installed haskell stack on my mac running macos Sequoia. When I try to run `stack setup -v` I get this. (I can access https://stackage-haddock.haskell.org/snapshots.json no problem on Firefox) Any ideas? % stack setup -v Version 3.1.1, Git revision 8127279fb48012945f47f73167a5ecbce5692965 x86_64 hpack-0.37.0 2024-11-04 21:12:00.897866: [debug] Checking for project config at: /Users/wakalabis/stack.yaml 2024-11-04 21:12:00.903483: [debug] Checking for project config at: /Users/stack.yaml 2024-11-04 21:12:00.903553: [debug] Checking for project config at: /stack.yaml 2024-11-04 21:12:00.903605: [debug] No project config file found, using defaults. 2024-11-04 21:12:00.919002: [debug] Use of Casa server enabled: (CasaRepoPrefix "https://casa.stackage.org", 1280). 2024-11-04…

With the new editorconfig-mode bundled with Emacs and evil-mode activated, I got a message like this when I open a file in a project with an .editorconfig file that defined indent_size: The local variables list in /home/fred/tmp/editorconfig-test/ or .dir-locals.el contains values that may not be safe (*). Do you want to apply it? You can type y -- to apply the local variables list. n -- to ignore the local variables list. -- to apply the local variables list, and permanently mark these values (*) as safe (in the future, they will be set automatically.) i -- to ignore the local variables list, and permanently mark these values (*) as ignored + -- to apply the local variables list, and trust all directory-local variables in this directory * evil-shift-width : 4 The problem seems to be that the built-in editorconfig-mode set evil-shift-width and check the safety of variable. But by default evil-shift-width is not safe. Setting the safe-local-variable property of this variable fixes the problem: (put 'evil-shift-width 'safe-local-variable #'integerp) Since the problem involves several packages, I don't know where to open a bug report. Where is the best place for a clean solution? in my init.el, it's easy but just for me in evil package because it's where evil-shift-width is initially defined in built-in editorconfig-mode because it's where the "problem" is triggered submitted by /u/fgiquel [link] [comments]

I recently have been giving doom emacs a try after using my own config for a year or so. Everything is great except I have to press C-SPC to preview files with find file. I made all of the consult commands preview automatically with consult-customize but find file is not a consult command and C-SPC is bound in vertico’s map. In my own config I really don’t have anything other than the standard consult and vertico setup and the previews are automatic for everything. Anyone know how to get vertico to preview files when using find-file? submitted by /u/SaltyTranslator402 [link] [comments]

I've just run into this today on GNU Emacs 28.3. If I try to run rgrep while my point is at something that superficially resembles a URL, rgrep seems to ping that URL before running. For example, I just tried putting this in my Scratch buffer example.com abc If I put the point on the second line and run M-x rgrep, it works as intended. If I put the point on the first line, I get a message in the minibuffer that says "Pinging example.com (Commercial)..." and hangs until I C-g out. Imagine my surprise when, earlier today, I tried to grep while the point happened to be at super.do_safety_check() and Emacs decided to ping the parked domain super.do instead of running (presumably, whatever crude regex is detecting URLs saw the super.do part and ignored the rest of the line). What is the intent of this feature? I've been digging through the docs and grep.el source code trying to find out what's causing this, but I struggle to understand what it's even intended to accomplish. submitted by /u/Mercerenies [link] [comments]

I am trying to add new regexp to compilation-error-regexp-alist-alist. I prefer to use rx as it make the regexp more maintainable but problem is that the rx does not "evaluate" in this case (cant find better term) I first thought that problem is with my rx but then i noticed rx has already been used with the built in ones (See: https://github.com/emacs-mirror/emacs/blob/6a299b3caceb2c73b932ba73849738faa8c5d975/lisp/progmodes/compile.el#L264 ) So i tried to take the example one from compile.el, slightly modified the name, and evaluated (pushnew '(gradle-kotlin-test ,(rx bol (| (group "w") ; 1: warning (group (in "iv")) ; 2: info "e") ; error ": " (group ; 3: file (? (in "A-Za-z") ":") (+ (not (in "\n:")))) ": (" (group (+ digit)) ; 4: line ", " (group (+ digit)) ; 5: column "): ") 3 4 5 (1 . 2)) compilation-error-regexp-alist-alist) ..and checked the result by: M-x describe-symbol compilation-error-regexp-alist-alist ..and then i can see rx being literally there as below, but i think it should evaluate to string regexp like others in list to work correctly. Alist of values for ‘compilation-error-regexp-alist’. Value: ((gradle-kotlin-test ,(rx bol (| (group "w") (group (in "iv")) "e") ": " (group (32 (in "A-Za-z") ":") (+ (not (in " :")))) ": (" (group (+ digit)) ", " (group (+ digit)) "): ") 3 4 5 (1 . 2)) (absoft "^\\(?:[Ee]rror on \\|[Ww]arning on\\( \\)\\)?[Ll]ine[ ]+\\([0-9]+\\)[ ]+of[ ]+\"?\\([a-zA-Z]?:?[^\":]+\\)\"?:" 3 2 nil (1)) .... What I am doing wrong? Note: My elisp skills are next to nothing, so hopefully only something simple is needed.. :) submitted by /u/BobFrame00 [link] [comments]

I have been trying to a find to not have ef-themes modify my font settings, only apply colour, but leave the variants and style alone. I would like to keep my fonts options as is, and using ef-themes completely modifies documentation pages and everything. submitted by /u/SillyParticular5802 [link] [comments]

First, I'm having a slight failure to launch here. I'm on macOS Ventura v13.2.1, Homebrew 4.4.4. Ran brew install emacs. Got a couple errors ==> Pouring gallery-dl--1.27.7.all.bottle.tar.gz Error: The `brew link` step did not complete successfully The formula built, but is not symlinked into /usr/local Could not symlink bin/gallery-dl Target /usr/local/bin/gallery-dl already exists. You may want to remove it: rm '/usr/local/bin/gallery-dl' and at the end Error: Not a directory @ dir_s_rmdir - /usr/local/Cellar/python-certifi and it cuts out there. Why is it asking me to gallery-dl? I need that for work.. Is there any way to work around this? Second, when I do install this, is there a beginners guide specifically for people who want to keep their environment as vanilla as possible for the time being, but provides certain highly recommended initial housekeeping tweaks? Thanks! submitted by /u/logos_sogol [link] [comments]

I'm trying to develop C# in Emacs, preferring Emacs over Visual Studio and Visual Studio Code, and all the recommended components to add to Emacs (Omnisharp, emacs-csharp, etc.) seem to be obsolete. Is there an actively maintained set of configurations recommended for C#? (My apologies if the question seems insufficient; caffeine has yet to kick in today.) Thanks in advance. submitted by /u/AlexKingstonsGigolo [link] [comments]

This version introduces many new features, most notably a visual panel for managing reference files and a well-designed, highly extensible hash table. Here is the changelog. Thank you for your attention: Version 0.4 (2024-11-04) Note! When running the new version for the first time, be sure to execute M-x org-zettel-ref-migrate to upgrade the data structure in the hash table. New Feature: Provides a visual management panel for source files org-zettel-ref-list (see Basic Usage -> Manage Source Files for details): Visualization: Provides a reference management panel Multi-column list: Displays the current references in a list format, with key columns such as Title, Author, and Keywords Rename: Allows renaming files in the format AUTHOR__TITLE==KEYWORDS.org within the panel Sorti…

This is a weird one, I use clangd for C++ development on Emacs. clangd I install from repositories sudo dnf install -y llvm clang clang-tools-extra while I compile emacs myself which does not matter because the issue happens on clang side. Anyway, here's the error I get when trying to use eglot with Emacs: [stderr] E[07:18:13.509] System include extraction: driver execution failed with return code: -1 - 'Executable "/usr/bin/clang-tool" doesn't exist!'. Args: [/usr/bin/clang-tool -E -v -x c++ -] [stderr] E[07:18:21.127] System include extraction: driver execution failed with return code: -1 - 'Executable "/usr/bin/clang-tool" doesn't exist!'. Args: [/usr/bin/clang-tool -E -v -x c++-header -] [stderr] PLEASE submit a bug report to https://github.com/llvm/llvm-project/issues/ and include t…

Is there an already made color theme similar to this syntax highlighting that I stumbled upon at Codeberg: gol.lisp submitted by /u/fm2606 [link] [comments]

I'm strugging to get the debugger running in emacs. On the cmd line I run bundle exec rdbg -c -- bundle exec rails server -b -p 3000. Any ideas how I can run a similar command using dape from emacs?? submitted by /u/dirtyfishtank [link] [comments]

Does anybody tried home row mod (https://precondition.github.io/home-row-mods) with app kanata - (https://github.com/jtroo/kanata) (qmk-like remaping for any keyboard) ? Looks like I can foget about vim-like keybindings in emacs. What do you think about combination of this two things? submitted by /u/j3k4 [link] [comments]

Have been checking AI assisted programming related tools for Emacs for a while. Very interested in this. Share what I am practicing right now, welcome to discuss on this topic: AI code completion: copilot.el. Github Copilot code completion inside emacs. Very reliable. Can complete both code and text (eg. inside org-mode) Code discussion: copilot-chat.el. Chat with github copilot. Since it use same account above, I assume one advantage of it over other LLM plugin is that it is free for people already subscribed to Github Copilot Code change / refactor: aider. for emacs integration, aider.el. With the most recent claude model, claude-3-5-sonnet-20241022. My feeling is that I should try it firstly before writing the code by myself, cause its coding ability and code quality is really good. Would be great to share your thought / experience on AI assisted programming, especially in emacs. Thanks. submitted by /u/Sad_Construction_773 [link] [comments]

submitted by /u/github-alphapapa [link] [comments]

submitted by /u/mstksg [link] [comments]

Hi everyone, u/TechnoEmpress and me are organizing a GHC 9.12 release party at the Modus Create Paris office, on November 12th, starting at 19:45 CET. There will be presentations about the new features, and we’ll chat about the new things that we learned recently about the Haskell language, and have a great time altogether. Whether you are a professional programmer, a researcher or a hobbyist, you are welcome! Pizzas will be provided, thanks to Modus Create! Registration link on meetup: https://www.meetup.com/fr-FR/haskell-paris/events/304376525 submitted by /u/terrorjack [link] [comments]

If we have a type for existential wrapping of some value with a constraint data Exists c where Exists :: forall a. c a => a -> Exists c I could write an instance for Show instance Exists Show where show (Exists x) = "Exists " ++ show x Or I could implement my own version of Dynamic type Dyn = Exists Typeable However, I can't provide an Eq instance for Exists Eq because == takes two parameters, and I have no way of telling if they are the same type. However, if I have Typeable and Eq, then it can work. However, I cannot provide two Constraints to Exists - only one. I tried using a type synonym type TypeEq a = (Typeable a, Eq a) but I cannot partially apply it in Exists TypeEq, even with LiberalTypeSynonyms. I eventually got it to work by creating an empty type class class (Type…

submitted by /u/gallais [link] [comments]

Due to the success of the last meetup, we are making the Vienna Haskell Meetup a regular occurrence, happening once every couple of months. We are hosting the next Haskell meetup in Vienna on the 28th of November! The location is the same as last time, at TU Vienna Treitlstraße 3, Seminarraum DE0110. The room will open at 18:00. We plan to have 1 talk starting at 19:00, currently planned to be about the PostgREST project. Depending on interest there might also be a short Show & Tell session giving people the opportunity to show off or talk about something they work(ed) on for 5-10 Minutes each. There will be time to discuss the presentations over some snacks and non-alcoholic drinks which are provided free of charge afterwards, with an option to acquire beer for a reasonable price. The meetup is open ended but we might have to relocate to a nearby bar as a group if it goes very late… There is no entrance fee or mandatory registration, but to help with planning we ask you to let us know in advance if you plan to attend here https://forms.gle/rgvANhpXWrGnQm4H6 or per email at haskellvienna.meetup@gmail.com. We especially encourage you to reach out if you would like to participate in the show&tell or to give a full talk so that we can ensure there is enough time for you to present your topic. At last, we would like to thank Well-Typed LLP for sponsoring the last meetup on short notice! We hope to welcome everyone soon, your organizers: Andreas(Andreas PK), Ben, Chris, fendor, VeryMilkyJoe, Samuel submitted by /u/Fendor_ [link] [comments]

We have a fully funded PhD scholarship available at the School of Computer Science at the University of St Andrews on “Dependent Types and Parallel Programming”. Any potential candidates are advised to contact Dr Chris Brown ([cmb21@st-andrews.ac.uk](mailto:cmb21@st-andrews.ac.uk)) for more information. Full details of the scholarship, the topic, and how to apply are here: https://blogs.cs.st-andrews.ac.uk/csblog/2024/10/24/fully-funded-phd-scholarship-in-parallel-programming-and-dependent-types/ The deadline for applications is the 1st March 2025, with a September start date (although there is room for some flexibility due to circumstances). International applications are welcome. We especially encourage female applicants and underrepresented minorities to apply. The School of Computer Science was awarded the Athena SWAN Silver award for its sustained progression in advancing equality and representation, and we welcome applications from those suitably qualified from all genders, all races, ethnicities and nationalities, LGBT+, all or no religion, all social class backgrounds, and all family structures to apply for our postgraduate research programmes. submitted by /u/Optimal_Trip9026 [link] [comments]

I'm happy to announce heftia-effects v0.5. https://github.com/sayo-hs/heftia heftia-effects brings Algebraic Effects and Handlers, a notable programming paradigm, to Haskell. It also supports higher-order effects, an important feature existing Haskell libraries have offered. This library is currently the only Haskell library with higher-order effects that fully supports algebraic effects. It is functionally a superset of all other libraries (especially the ReaderT IO-based ones like effectful and cleff). Despite its rich features, it maintains good performance. Additionally, its well-founded theoretical approach, grounded in the latest research, positions it to become the future of all effect systems—not just within the Haskell language. Heftia should be a good substitute for mtl, pol…

If you or one of your students recently completed a PhD (or Habilitation) in the area of functional programming, please submit the dissertation abstract for publication in JFP: simple process, no refereeing, open access, 200+ published to date, deadline 29th November 2024. Please share! http://www.cs.nott.ac.uk/~pszgmh/jfp-phd-abstracts.html submitted by /u/grahamhutton [link] [comments]

The sdml-mode package has been updated to version 20241104.1705.

The treesit-ispell package has been updated to version 20241104.1520.

The tawny-mode package has been updated to version 20241104.1432.

The smart-mark package has been updated to version 20241104.1311.

The e2wm package has been updated to version 20241104.914.

The window-layout package has been updated to version 20241104.900.

The helm-core package has been updated to version 20241104.43.

I want to use my emacs with orgmode to do my homework. But sometimes I have errors and I want not only write correct answer/sentence/etc., but also leave my original variant. So that I can see later what I made a mistake about. Orgmode allows me to cross out old text, but I also want to emphasize new text. Is there any way to do something like "diff by word", e.g. write -bad-+good+ and get red "bad" and green "good"? submitted by /u/FirmSupermarket6933 [link] [comments]

submitted by /u/github-alphapapa [link] [comments]

Hey all, I released an interactive explorer for trees in the scala 3 reflect module. Its main purpose is to help with debugging and viewing trees of scala code as seen by the scala 3 reflect module. It is more or less a replacement for `Printer.TreeStructure`, only it does not generate a string but writes an interactive HTML file to disk. You can find the project here: https://github.com/felher/s3te/ A (very small) example looks like this: https://preview.redd.it/wmmydax6ivyd1.png?width=3836&format=png&auto=webp&s=d371403a0a24f83ad521dc16e0aff6178022afb3 The github site also contains a short video showing the usage and features of the tool. Feedback is very welcome! submitted by /u/fel_her [link] [comments]

Hello, I'm a returning scala user. I know that Scala has access to many ways of reading and writing files: old Java API java.io newer Java API java.nio scala.io.Source OS-lib os._ functions The official docs says that the OS-lib API from scala toolkit aims to replace scala.io.Source API: OS-lib also aims to supplant the older scala.io and scala.sys APIs in the Scala standard library. but OS-lib isn't part of the scala standard lib, and the API of OS-lib to deal with files seems more weird than scala.io one. Is it really becoming the de-facto way of dealing with file IO? Thanks for your help! Also, as an additional question, I'm wondering if all the libs from the Scala toolkit are the community-agreed option for their respective use-case, or if they are just an arbitrary choice of lib made by a small part of the community. submitted by /u/tbagrel1 [link] [comments]

submitted by /u/eed3si9n [link] [comments]

submitted by /u/ghostdogpr [link] [comments]

Hi. During my college days, I established a Zettelkasten through Obsidian, a software which helps link notes. Since starting my new job however, my work laptop does not allow me to install Obsidian or any other custom software. As a result, I am unsure how to proceed with my preexisting Zettelkasten. I am aware that Zettelkastens do not depend on external software programs to be useful, but I will admit I have been more reliant on this technology than I'd like (appreciating features such as pictures), and have grown comfortable with it. I have considered getting the mobile version of the software or switching entirely to raw markdown files, but I am wondering whether there are other alternatives.  ( 3 min )

Question about denote customization here. There is an example of writing convenience functions that use a let and denote-add-prompts to override the denote-prompts list and cause a given function to prompte differently. The example modifies the behavior of the denote function. I am trying to write a custom function that does that for denote-rename-file: emacs-lisp (defun my/denote-rename-file-with-date () (declare (interactive-only t)) (interactive) (let ((denote-prompts (denote-add-prompts '(date)))) (call-interactively #'denote-rename-file))) But it does not seem to work. I've also tried simply overriding denote-prompts for the let without using denote-add-prompts but it doesn't work. I wonder if this method may only work with denote and is not supported by denote-rename-file? Has anyone tried to do anything like this and suceeded? submitted by /u/ethanzanemiller [link] [comments]

At the tail end of installing with emacs-plus, for example: brew reinstall emacs-plus@29 --with-imagemagick --with-native-comp --with-xwidgets --with-no-frame-refocus --with-modern-black-dragon-icon I get a prompt like this: To link the application to default Homebrew App location: osascript -e 'tell application "Finder" to make alias file to posix file "/opt/homebrew/opt/emacs-plus@29/Emacs.app" at POSIX file "/Applications" with properties {name:"Emacs.app"}' This will create a link (if it already exists, it needs to be removed of course) but then Spotlight does not seem to utilize this. This seems to be a thing with Spotlight and soft links. What is the recommended practice for smooth interop with OSX and launching without using the mouse? Right now, as a workaround, I will pin in my dock so at least it can be launched from the dock, but launching via Alt/cmd space would be ideal. submitted by /u/AnotherDevArchSecOps [link] [comments]

Recently, I tested out this extension in the VS Code editor, finding it straightforward and user-friendly. Apart from the detailed TODO lists in org-mode, is there a package for managing todo lists that is similar to Todo+? submitted by /u/xbelanch [link] [comments]

Running ispell-buffer or TeX-ispell-document on the following finds no errors: \documentclass{article} \begin{document} \newcommand*{\o}{test} Theorm \end{document} But it works on this one: \documentclass{article} \begin{document} \newcommand*{\oo}{test} Theorm \end{document} Isn't this weird? Should I not be defining single letter commands? submitted by /u/mn_malavida [link] [comments]

Hello everyone. I've been trying to figure out what is the best setup for Jupyter notebooks in Emacs. The most recent information I found is in this thread. [See the bottom of the post for a more detailed overview] The consensus approach seems to be the same I've landed on: I keep using vs code for notebooks, emacs for everything else I've been wondering: would it be possible to have better support for Jupyter notebooks in Emacs? Maybe I'm too ignorant of the underlying setup, but intuitively it seems to me that this should be doable, though it will require some work. Perhaps leveraging some newer Emacs features like treesiter and org-babel in order to combine multiple modes in the same buffer. Focusing specifically on python notebooks, as it's the use-case I'm most familiar …

I got a 61-key keyboard, so called 60% keyboard uses the Fn function key in combination with the normal character keys to perform the work of the arrow and PgUp keys etc. Using the Fn key with the regular keys is awkward so I'm looking for the conventional Emacs key combos which use alphanumeric keys in combination with Shift,Alt and Ctrl. The cursor keys, ↑ ↓ → ← Ins Del Home End PgUp PgDown PrintScreen ScrollLock Pause What are the usual key combinations that perform those roles, mainly in Emacs? The same for vi, the terminal and the console would be a bonus. submitted by /u/vfclists [link] [comments]

Does anybody have any suggestions for how to approach tracking down what is causing this treesitter error? There are no messages in clangd::stderr. After almost every edit on brand new project It freeze and ctrl-g exits the freeze and I get this back trace. I am using c++-ts-mode and treesitter works fine with the other languages I use. It even worked fine when I set emacs up to edit C++ last winter. This is showing up in the messages buffer: Applying 1 edits to `main.cpp' ...done Quit Back to top level Saving file /home/user/Programming/cpp_dev/vulkan_triangle/main/main.cpp... Wrote /home/user/Programming/cpp_dev/vulkan_triangle/main/main.cpp Entering debugger... The Entering debugger emits this output: Debugger entered--Lisp error: (quit) looking-back("^[[:space:]]*" 2…

I just recently started using yasnippets and would like to be able to see them in the company pop-up menu that appears when typing as suggested items. Essentially, the output of (M-x company-yasnippet). I've tried all the different configurations I've read online and nothing has worked, except for my current config which "sort of" works? (use-package yasnippet :ensure t :config (setq yas-snippet-dirs '("~/.config/doom/snippets")) (yas-global-mode 1)) (defcustom lsp-enable-snippet t "Enable/disable snippet completion support." :group 'lsp-mode :type 'boolean) (defvar company-mode/enable-yas t "Enable yasnippet for all backends.") (defun company-mode/backend-with-yas (backend) (if (or (not company-mode/enable-yas) (and (listp backend) (member 'company-yasnippet backend))) backend (append (if (consp backend) backend (list backend)) '(:with company-yasnippet)))) (setq company-backends (mapcar #'company-mode/backend-with-yas company-backends)) (defun add-yasnippet () (setq company-backends '((company-capf :with company-yasnippet)))) (add-hook 'eglot--managed-mode-hook #'add-yasnippet) This works if I reload my config (space-h-r-r), and only then can I see my yasnippets as recommended items, and only in elisp-mode. I would like this to work for latex-mode specifically (all modes would be nice too), but reloading my config (space-h-r-r) in a .tex file actually makes company mode stop working all together. This was a previous reddit thread I went through and took some code from, but It's still not working as intended. submitted by /u/Character_Peanut3482 [link] [comments]

I'm attempting to use denote to search/keep documents -- not notes -- but an archive of documents of various types. Retroactively, I'm renaming some files that I've already stored digitally in order to make them searchable by denote. Cleverly, denote chooses the date in the file system for the file when setting the ID, but in some cases I would like to modify the date embedded within the ID to be accurate to when I know the file was received (instead of when it was scanned). Is it valid to manually update the ID in the file name? I looked to see if there was a `denote-change-identifier` or some such, but didn't see anything. submitted by /u/ethanzanemiller [link] [comments]

submitted by /u/jamescherti [link] [comments]

Howdy! I have decided I'll go back to using Emacs as my default IDE. I havent been developing in Emacs for about ~7 years, and back then I was a fairly basic user. Basically only used the default configuration with a few small adjustments. I'm thinking I'll try parentheses all the way on my home system, i.e. Emacs + StumpWM + (non)Guix (my brain is getting old and I realize I need ONE language with a simple syntax for system configuration). Where should I start if I want to re-learn Lisp/Scheme and Emacs? What Emacs distribution should I use if I want batteries included? I'm thinking that it might be wise to try Doom or Spacemacs (never been a Vim user (only a little bit of vi), but I've heard the default key-bindings are less painful). What I need out of the box is great support for developing and debugging in C++, Rust, LaTex and Python (I'm using VSCode for that ATM, but it does not feel sustainable). Being able to experiment with self hosted or remote hosted AI code assistants is also a requirement. Also, I only wish to use Emacs in a terminal (out-of-the-box emacs-nox is my the default terminal editor right now). I hope this doesn't seem too crazy. If you want to give me some advice or just a moral boost, feel free to comment! Reminder/clarification, the questions were: Where should I start if I want to re-learn and what Emacs distribution might be the best fit? Cheers! submitted by /u/SeaInevitable266 [link] [comments]

I was writing some text few minutes ago, and I made a small code snppet for illustration: (let (|(some-var-I-want-to-remove ( ... )) (another-var nil) (more-var)) ( ... )) I usually use three dots to denote "uninteresting" content. But for some reason I got to think that dot is a valid character for identifiers in elisp. So '...' ought to be a valid identifier? Turns out it was. So is also the pipe symbol. So I can do this: (defun ... (&rest _ignored)) and the above let-block can now be evaluated without errors. It is not useful to evaluate code that does nothing, of course, but perhaps it can be typed into the source code without Emacs complaining. A carefully constructed pseudo-code where everything evaluates to nothing can be interleaved with real code as examples or something. I don't know, just a thought. Edit: of course (defvar ... nil) should also work :-). submitted by /u/arthurno1 [link] [comments]

submitted by /u/tritlo [link] [comments]

submitted by /u/jumper149 [link] [comments]

submitted by /u/Worldly_Dish_48 [link] [comments]

Hi everyone, I want to share that I've just created three maintenance issues in the dunai project that are especially suited for beginners and people with less experience in functional reactive programming (FRP) and even in Haskell. For those unfamiliar, dunai is an open-source, generalized reactive programming library that allows writing reactive programs, and can be used to implement Classic FRP, Arrowized FRP and Reactive Values. Dunai is frequently used to write interactive applications (e.g., user interfaces and games), although it's very versatile. Via it's sister library bearriver, you can compile Yampa applications to use bearriver/dunai instead of Yampa. See https://github.com/ivanperez-keera/Yampa?tab=readme-ov-file#games-and-applications for a list of Yampa games out there. They issues I opened are here: https://github.com/ivanperez-keera/dunai/issues?q=is%3Aissue+is%3Aopen+label%3Abeginner In order from easiest to hardest, they are #444, #445, and #446. I've tried to be very explicit in the steps necessary, to make it as clear as possible how the PRs should be prepared. My hope is that this will help people who would like to contribute to an open source Haskell project become familiar with the process used to keep the code well maintained. The next release of dunai will come out on Dec 21st, so there is plenty of time to prepare these well and get them integrated. Anyone is welcome to contribute! Happy Haskelling! submitted by /u/ivanpd [link] [comments]

Hi everyone! I’m a Haskell beginner, and I’m having trouble with a particular type of recursive problem. Well, I don’t know if you could formally group them together in the same category but I find the solutions all follow a similar pattern. Please note I’m am not looking for any super higher order implementations, I am a beginner trying to learn how to implement from the ground up. Some examples of these problems are: Subsequences of a list, eg: “ABC” has subsequences [“A”, “B”, “C”, “AB”, “BC, “AC”, “ABC”, “”] A solution to this problem is subseq []= [[]] subseq (x:xs) = subseq x ++ map (x:) (subseq xs) Partitions of k Eg the partitions of 3 are all the combinations of integers that sum to 3. [[1,1,1], [1,2],[3]] A solution could look something like partitions 0 = [[]] partitions n = concatMap (/x -> map(x:) partitions (k-x) )) [1..n] This problem was so so so challenging for me, I needed hours to work through it (I am clearly not thinking about these problems in the right way). And one final example of a problem I would struggle with would be finding all permutations of a list or something like that, I won’t put an example as I am sure you get the jist by now. In terms of picking up on a pattern, I kind of get the idea that you want to map something over a smaller version of the problem, but I’m still struggling with identifying the recursive pattern. Does anyone have any advice, one thing I tend to do is think about how the code is executing as opposed to the rules/ patterns I am enforcing in the code. This gets tricky because trying to fully execute this code in my brain gets confusing very very quickly. I think I need to switch from thinking so procedurally, I just don’t know how. I have an exam coming up soon, do you think I can have this style of problem understood in a couple of days? Thanks for your help everyone :) submitted by /u/Lucky_Marzipan9464 [link] [comments]

I'm having trouble building (macOS) a project because the ghc compiler errors out when building the freetype package. (in Types.hs) Ex: /var/folders/05/q_w943b53vsbkg2594_zvsz00000gn/T/ghc8852_0/ghc_93.c:65:17: error: error: incompatible pointer to integer conversion assigning to 'ffi_arg' (aka 'unsigned long') from 'HsPtr' (aka 'void *') [-Wint-conversion] | ^ *(ffi_arg*)resp = cret; ^ ~~~~ This actually happens with two projects/packages I'm trying to build. Where do I find the source on my system for The Types.hs that causes the error ? A find in my home directory doesn't locate it, so cabal must be hiding it somewhere else. EDIT: btw, this seems to be same/similar issue: https://gitlab.haskell.org/ghc/ghc/-/issues/23456 submitted by /u/964racer [link] [comments]

The paredit package has been updated to version 20241103.2046.

The org-node-fakeroam package has been updated to version 20241103.2000.

The sideline package has been updated to version 20241103.1524.

The php-cs-fixer package has been updated to version 20241103.1232.

The mu4e-overview package has been updated to version 20241103.1202.

The compiler-explorer package has been updated to version 20241103.1129.

The helm package has been updated to version 20241103.444.

The transducers package has been updated to version 20241103.35.

submitted by /u/petrzapletal [link] [comments]

The dylan package has been updated to version 20241102.2315.

The eglot-luau package has been updated to version 20241102.1924.

The khoj package has been updated to version 20241102.1923.

The lsp-pyright package has been updated to version 20241102.1425.

The doom-modeline package has been updated to version 20241102.1416.

The projectile package has been updated to version 20241102.1410.

The rime package has been updated to version 20241102.1302.

The dracula-theme package has been updated to version 20241102.1301.

The el-job package has been updated to version 20241102.1057.

The gdscript-mode package has been updated to version 20241102.1010.

The chatgpt-shell package has been updated to version 20241102.850.

I have the following setup in my init.el file. However, when I use consult-buffer it displays all the buffers between both workspaces. Only if I use persp-list-buffers can I see the buffers in the current workspace. However, it is not easy to switch between buffers within the persp-list-buffers, so I was trying to figure out how to make consult-buffer only display buffers in the current perspective workspace: (use-package perspective :straight t :bind ("C-x C-b" . persp-list-buffers) ; or use a nicer switcher, see below :custom (persp-mode-prefix-key (kbd "C-c w")) ; pick your own prefix key here :init (persp-mode)) (setq persp-state-default-file "~/.emacs.d/config/persp-save-state") (add-hook 'kill-emacs-hook #'persp-state-save) (persp-state-load persp-state-default-file) submitted by /u/waterstrider123 [link] [comments]

hello people! i try and use Xah Fly Keys, as im currently trying different emacs keymap layouts, and it does not want to launch on startup. i'd like to have xah-fly-keys be automatically activated as a minor mode whenever i open Emacs, but instead i consistently fall onto Fundamental mode. the only packages i installed, alongside what vanilla emacs did install, are xclip and xah-fly-keys and devil-mode (and i do not actively use devil-mode, nor have added anything to devil-mode regarding init.el). all installed through M-x list-packages i have uninstalled devil just now, and still the same problem. only modification i have added to emacs was the .emacs.d/init.el file, which has the following : (setq org-todo-keywords '((sequence "TODO" "IN-PROGRESS" "WAITING" "|" "DONE" "CANCELED"))) (require 'package) (add-to-list 'package-archives '("melpa" . "https://melpa.org/packages/") t) (package-initialize) (require 'xah-fly-keys) (xah-fly-keys-set-layout "azerty") ; or your preferred layout (xah-fly-keys 1) (xah-fly-command-mode-activate) am i doing something wrong, or did i miss something? i had to apply the correct keyboard layout using functions INSIDE of emacs, so i feel like XFK is acting a bit weird. especially when i modified init.el for org-mode, and that worked very well. hope everyone is doing well, cheers :) submitted by /u/arni_ca [link] [comments]

Is anyone here familiar with Franca IDL? If yes, do you know why there isn't a native support for FIDL in emacs? submitted by /u/DiegoG89 [link] [comments]

I like to use tab-line-mode (note not tab-bar) to keep a set of "active" buffers for my current work. By the way, tab-line-mode is improved in Emacs 30 and I recommend giving it a try. When I work on a remote machine through ssh, I have a Emacs daemon on it, and all buffers live there even after I disconnect. However, the tabs of tab-line-mode seem to associate with the frame, so each time I start a new frame I have to bring those tabs back manually. I also want to have keep those tabs/buffers across sessions, as much as possible. There are several project/session management packages out there, but it seems only tab-bar-mode is mentioned. Is there a package which can do save and load tab-line tabs in different frames/sessions? Thanks for reading this long question! submitted by /u/linwaytin [link] [comments]

I'm not great with this stuff. Does anybody see anything obvious? This happens when lsp mode is turned off. I've never had an emacs lockup before and am not sure what to look for. It seems to be something wrong with projectile based on what its freezing at but why would it be having a problem with this backgrace is the result of a pkill -SIGUSR2 emacs Debugger entered--Lisp error: (minibuffer-quit) #() projectile-completing-read("Find file: " ("apps/app.cpp" "CMakeLists.txt" "README.md" "apps/CMakeLists.txt" "build/CMakeCache.txt" "build/CMakeDoxyfile.in" "build/CMakeDoxygenDefaults.cmake" "build/CMakeFiles/3.30.5/CMakeCCompiler.cmake" "build/CMakeFiles/3.30.5/CMakeCXXCompiler.cmake" "build/CMakeFiles/3.30.5/CMakeDeterm…

I need to search by tag throught my **entire notes**. Why isn't there a simple, definitive answer? There's always "install this, set up that, add that hotkey, type that command first, and then..." or "add that itnto agenda"? What a bullshit. Why add it into agenda in order to search by tags? submitted by /u/b-dada9k [link] [comments]

My emacs config was working perfectly well and I was trying to setup nano-emacs. I have no idea how all this happened, but some of my init.el contains these strange and text in various places which did not appear before. The following is an example and whenever I try to open emacs I now also get invalid syntax error for "#f". Please let me know if there is a way to resolve this. Everytime I try to remove all these tags, they are put back in my init.el file cause everything to mess up #+begin_src emacs-lisp (use-package svg-tag-mode :straight t) (use-package svg-lib :straight t) ;;(global-svg-tag-mode t) (defun enable-svg-tag-mode-for-agenda () "Enable svg-tag-mode only for agenda.org." (when (string-equal (buffer-file-name) (expand-file-name "~/Dropbox/Documents/Orgzly…

I am trying to learn supercollider and cl-collider. If I execute this ```lisp (require 'cl-collider) (in-package :sc-user) (named-readtables:in-readtable :sc) (setf s (make-external-server "localhost" :port 48800)) (server-boot s) (server-quit s) `` in a buffer, usingsly-eval-buffer`, it works fine. But if I use org and org-babel and define *s* in a separate block, it doesn't work: ```org ** Setup =supercollider= +name: sesh +begin_src lisp :session mysession (require 'cl-collider) (in-package :sc-user) (named-readtables:in-readtable :sc) (setf s (make-external-server "localhost" :port 48800)) (server-boot s) +end_src ** Free =supercollider= +name: sesh +begin_src lisp :session mysession :results output ;; (free synth) (server-quit s) +end_src ``` Likewise, this also do…

Hi! I'm thinking about a subset of monads, whose (>>=) function calls its right hand side argument at most once. So, it includes monads like Maybe, Either, Reader, Writer, State, Coroutine, etc., but excludes the List monad. Does anyone know, if there's a proper established name for such a thing? Thanks :) submitted by /u/Familiar-Place5062 [link] [comments]

I'm trying to implement some types and functions to better understand the language, in particular I want to define a Scalar typeclass and a VectorSpace typeclass. The first problem is with the Scalar typeclass. In the following I'd want something like instance (Num a) => Scalar a where and not only make Float a Scalar class Scalar k where -- minimal implementation (.+.) :: k -> k -> k zeroS :: k (.*.) :: k -> k -> k unitS :: k negateS :: k -> k inverseS :: k -> k -- defaults: (.-.) :: k -> k -> k (./.) :: k -> k -> k s1 .-. s2 = s1 .+. (negateS s2) s1 ./. s2 = s1 .*. (inverseS s2) instance Scalar Float where (.+.) = (+) (.*.) = (*) zeroS = 0 unitS = 1 negateS = negate inverseS x = 1/x The second problem is with the VectorSpace typeclass, becuase the following won't compile becuase the k parameter causes ambiguity in the definitions of the functions that have only v as arguments: class (Scalar k) => VectorSpace k v where -- minimal implementation (^+^) :: v -> v -> v zeroV :: v (.*^) :: k -> v -> v -- defaults negateV :: v -> v (^-^) :: v -> v -> v (^*.) :: v -> k -> v (^/.) :: v -> k -> v negateV = ((negateS unitS) .*^) v1 ^-^ v2 = v1 ^+^ (negateV v2) (^*.) = flip (.*^) v1 ^/. x = v1 ^*. (inverseS x) Ideally I'd want to be able to make type Vector k = [k] an instance of VectorSpace. Can someone help me figure out how I could achieve this kind of typeclass? submitted by /u/Dumb-Ptr [link] [comments]

submitted by /u/tikhonjelvis [link] [comments]

Hello everyone, I'm excited to announce my first simple emacs package: auto-tab-groups. Inspired by the excellent project-tab-groups by Fritz Grabo, this package simplifies and generalizes tab group management in Emacs. https://preview.redd.it/35yptkk7fhyd1.png?width=835&format=png&auto=webp&s=1109ce770818d2abe24255499f1400f9d0b63611 auto-tab-groups allows you to link any command (or list of commands) to specific tab groups. When a linked command is executed, the package intelligently switches to the associated tab group if it exists, or creates a new one if needed. This makes organizing your Emacs workflow incredibly flexible and easy. You can manage projects, mails, news-feed, file management tasks effortlessly in differnet tabs, and automatically close them when done. Here's a quick …

submitted by /u/self [link] [comments]

I use white text on black background and would like to know what others use for setting fg/bg colours? Something that works with hl-mode, marked regions and function highlighting. I suppose, it'd would mean setting the colours for hl-mode and other bits too. I'm not too keen on themes unless it's builtin and preferably white on black. what colours do you use? submitted by /u/10vatharam [link] [comments]

submitted by /u/jamescherti [link] [comments]

hello everyone, loving emacs and starting to get the hang of it, but i notice my left pinky is quite sensitive and easily hurts after a bit. i find myself having to extend my fingers a good amount when doing C-etc commands, as i have to use the left pinky to press Ctrl most of the time. obviously, if that's the only problem i have with emacs keybindings and i can just use the arrow keys to navigate (as i find the keyboard shortcut navigations too spread out to be usable easily), then i can just take the time to remap keybindings and have the uncomfortable modkeys be bound to more accessible keys i otherwise don't use (Caps Lock for example), all good. but that got me thinking and after doing some research, where i found ergoemacs-mode and fly-keys, i wanted to know if anyone found some …

Hi, I have configured Emacs into a dedicated music player program which I've named "muu", it can be found here: https://codeberg.org/Heathcliff/muu muu is a music player built on GNU Emacs and EMMS (Emacs Multimedia System). I'm putting it up in the hope that it will be helpful for other users, raise interest in the EMMS framework ... and maybe someone will like it and use it! I created this because I did not find that there existed any good keyboard-driven, filesystem-oriented music player out there. The closest alternative would be the music player MOC, which muu is heavily inspired by (essentially, the goal of muu is to be a clone of MOC). muu is intended to be a standalone program (a separate Emacs-process). The rationale for this is to achieve a tightly integrated music player program, with quick single-key keyboard shortcuts among other things. More information, installation guide et.c. can be found on https://codeberg.org/Heathcliff/muu submitted by /u/u64u [link] [comments]

Thanks to Sacha Chua submitted by /u/y1okqw711kj0 [link] [comments]

https://preview.redd.it/9v2qssxk18yd1.png?width=554&format=png&auto=webp&s=1f41612fee3bef9227b815efd88c0d6a453b055c I'm using dap-dlv-go in dap mode. But when my program stops at a break point I can't see the full set of local data. Just the beginning of the variables/value followed by `...` like the image below. The same version of dlv and Go work in VSCode flawlessly so I'm sure it's my configuration. I know there are some config options for VSCode like `maxVariableRecurse` and `maxArrayValues` is it possible to set those in emacs somehow? and Where? Please and thanks. submitted by /u/dirtyfishtank [link] [comments]

The hyperdrive package has been updated to version 20241101.2353.

The nerd-icons-corfu package has been updated to version 20241101.2309.

The ob-dall-e-shell package has been updated to version 20241101.2256.

The dall-e-shell package has been updated to version 20241101.2256.

The zig-mode package has been updated to version 20241101.2146.

The code-cells package has been updated to version 20241101.1618.

The magik-mode package has been updated to version 20241101.1559.

The claudia package has been updated to version 20241101.1402.

The avy package has been updated to version 20241101.1357.

The ace-link package has been updated to version 20241101.1344.

The dap-mode package has been updated to version 20241101.659.

The gitlab-pipeline package has been updated to version 20241101.356.

submitted by /u/SrPeixinho [link] [comments]

submitted by /u/peterb12 [link] [comments]

(Just sharing this in case somebody might find it useful) A long while ago I created an ugly but working nix/haskell shebang that allows writing scripts in haskell that actually compiles and caches a script into a binary which could be reused at later script invocations. gist: #!/usr/bin/env nix #!nix shell nixpkgs#cached-nix-shell --command sh -c ``nix store add "$(readlink -f "$1")" | xargs -I % cached-nix-shell -p 'runCommand "cached-nix-script" {} "mkdir -p $out/bin; ${(haskellPackages.ghcWithPackages (pkgs: with pkgs; []))}/bin/ghc -O2 -o $out/bin/cached-nix-script ${builtins.storePath %}"' --exec cached-nix-script "${@:2}"`` sh main :: IO () main = do putStrLn "Hello World!" nix shell nixpkgs#cached-nix-shell uses flakes eval-cache to instantly bring cached-nix-shell from cach…

This is your opportunity to ask any questions you feel don't deserve their own threads, no matter how small or simple they might be! submitted by /u/AutoModerator [link] [comments]

I am recreating the architecture of my current employeer (mid-size insurance company) but done correctly (at a very basic level of course) as a personal project. I'm a fan of type safety, the APIs were already built using Smithy, the frontend using ScalaJs and of course, all the microservices in Scala. My doubt comes when interacting with messaging brokers (Kafka or RabbitMQ) is there any way to generate a “contract” to have type safety in the messages that are sent? - I know that Smithy is protocol agnostic, but I can't find any examples where it is used for brokers, is this possible? - I was thinking about a shared library with all the types that will be send/received from the broker. But this probably will introduce a problem with versioning and force me to re deploy multiple microservices just because some type in the shared library changed. submitted by /u/Nojipiz [link] [comments]

I am looking for a bachelor thesis topic. I want to pick a topic related to programming languages, compilers, maybe some debuggers. These falls in more of a informatics theory field, but my specialization is software engineering. That’s why I need to find something related to software but indeed have connections to my interests. Could anybody recommend any interesting topics that I might pick? Target languages of a lab I want to work with are Javascript, R, Julia, Racket and Scala submitted by /u/Content_Lemon9994 [link] [comments]

submitted by /u/cofix42 [link] [comments]

I am very curious about how you use properties in orgmode. My question is about functionality: I can use tags for filtering, for example... but properties? Do you use them to store details? Isn't a simple bulleted list enough? submitted by /u/punkelbel [link] [comments]

ORG-NEWS feed is now part of planet.emacslife.com's blog roll. You will see an ORG-NEWS post to /r/planetemacs as soon as a future commit happens on ORG-NEWS. At the time of this post, you can already see plenty of etc/NEWS entries. submitted by /u/y1okqw711kj0 [link] [comments]

I am pretty new to emacs and I am using doom emacs. I recently discovered org-agenda and want to get reminders for my scheduled tasks. All the options I could find online seem to be for Linux and not for Windows. I did come up with below solution with org-wild-notifier.el. (use-package! org-wild-notifier :config (setq org-wild-notifier-alert-time 10) ;; Alert 8 minutes before the event (org-wild-notifier-mode)) (defun windows-notification (title message) "Display a Windows notification using PowerShell." (message "Sending notification: %s - %s" title message) ;; Log to *Messages* buffer (start-process "powershell-toast" nil "powershell" "-Command" (concat "New-BurntToastNotification -Text '" title "', '" message "'"))) ;; Advise the org-wild-notifier--notify function (defun my-org-wild-notifier--notify (message) "Call the original notify function and send a Windows notification." (windows-notification "Reminder" message) ;; Call the original notify function (org-wild-notifier--notify message)) ;; Replace the original notify function with our advised version (advice-add 'org-wild-notifier--notify :override #'my-org-wild-notifier--notify) But this is sending 30 notifications for every event instead of 1 notification. Below is the log from messages buffer. Sending notification: Reminder - TEST THIS at 01:23 AM (in 10 minutes) [30 times] error in process sentinel: apply: Creating pipe: Too many open files error in process sentinel: Creating pipe: Too many open files Please help with fixing this code or suggest another solution I can use to generate notifications in Window. submitted by /u/Cold_Pressure6992 [link] [comments]

The jwt package has been updated to version 20241031.2258.

The evenok package has been updated to version 20241031.2134.

The circe package has been updated to version 20241031.1807.

The racket-mode package has been updated to version 20241031.1539.

The evil-collection package has been updated to version 20241031.1423.

The ninja-mode package has been updated to version 20241031.1344.

The clojure-ts-mode package has been updated to version 20241031.648.

The json-navigator package has been updated to version 20241031.630.

The gnosis package has been updated to version 20241031.505.

I have a codebase in java that I need to port over to scala. Whats my best best on porting it over as quickly as possible. Are there any tools that allow you to do that. Does anyone know people who do this kind of stuff professionally. submitted by /u/ascorbics [link] [comments]

Some times my c-x c-s shoprtcut acticates this function and it wont let me save with this shortcut. I dont know what to do. How can I set the autosave again to ve c-x c-s? submitted by /u/Yare-yare---daze [link] [comments]

submitted by /u/vfclists [link] [comments]

I believe there is, but I've forgotten because I never had a cause to use it, though I suspect it must be quite simple. submitted by /u/vfclists [link] [comments]

submitted by /u/mavit0 [link] [comments]

Hi all, When working on python files, often times I need to run the interpreter with M-x run-python. However, this splits the window in half everytime. Is there a way to reduce the size of this window to say about 20% of the entire frame? And also to specify to make a vertical split regardless of the total area of the frame? Thanks. submitted by /u/kn0xchad [link] [comments]

I have my Emacs (Doom Emacs) set up with LSP, format on save, etc., and this is working for me. Recently I cloned a project from GitHub, and I made some changes and realzed my settings are rewriting the whole file, and I don't want _all_ my rules applying to other people's projects. I need a way to tell Emacs that a project is mine or someone else's. I was thinking if I can have a flag set at the project level which will disable some settings project-wide instead of having to create a .dir-locals.el each time. submitted by /u/floofcode [link] [comments]

On a supercomputer, people usually submit a job with sbatch runfile.sh. I am wondering if there is an option to run a particular command on a shell source block in Org mode, but instead of running the script with bash. Thanks. submitted by /u/linwaytin [link] [comments]

I made a small dirty hack to allow the same keybinding to switch X11 keyboard layouts and input methods in Emacs. I think I got the idea somewhere on the Internet long ago and incorporated it into my self-written window manager, but now I think it would be nice to have a separate utility - https://codeberg.org/algor512/eswitch I presume it may not work with large desktop environments, but hopefully you can use their own tools for that. I don’t know whether it will be helpful for someone else; at least I'm happy using it :) submitted by /u/algor512 [link] [comments]

Been doing mad research and trying different solutions the past few days to unlock basic functionality from similar to the Obsidian plugin Dataview. The solution, after lots of googling consists of using a modified org-ql dynamic block function. See the function posted by hrehfeld on https://github.com/alphapapa/org-ql/pull/239#issuecomment-1213052966 I've tried it with custom file and it works perfectly. Valid parameters include: :scope The scope to consider for the Org QL query. This can be one of the following: `buffer' the current buffer `org-agenda-files' all agenda files `org-directory' all org files `(\"path\" ...)' list of buffer names or file paths `all' all agenda files, and org-mode buffers The query #+BEGIN: my-org-ql :scope ("~/org/contacts.org") :query (property "position") :columns (heading ((property "position") "Position") ((property "organization") "Organization")) :sort nil #+END contacts.org consists of headings where each heading is a contact with metadata. * Name LastName :PROPERTIES: :type: person :context: work :organization: [[id:96b109ff][Some org]] :position: Developer :tel_work: :tel_home: :tel_mobile: :ID: 4fab8b24-f51a-4598-91e3-012743e2f62f :ROAM_ALIASES: name :END: submitted by /u/RoInRo [link] [comments]

So i just wondering how to do it, cause i read the helping guide and i search everything and i cant make it truncate by default, i check state of the variables and all i can wonder. Here is the part of my config.org, that changes the truncate ** Toggle truncate lines. #+begin_src emacs-lisp ;; (setq truncate-lines nil) (setq-default truncate-lines t) (setq-default global-visual-line-mode t) (add-hook 'c-mode-hook (lambda () (setq truncate-lines t))) (add-hook 'latex-mode-hook (lambda () (setq truncate-lines t))) #+end_src submitted by /u/KuronePhoenix [link] [comments]

Running emacs -Q for emacs 29.4 (build 2, x86_64-w64-mingw32): ~/.ssh $ cd /sshx:oracle-root:/ /sshx:oracle-root:~/ $ pwd /sshx:oracle-root:/home/opc/ /sshx:oracle-root:~/ $ /bin/pwd / There should be no tilde before / on the second line and the `pwd` command (which is eshell's own `pwd` written in elisp) on the second line should not report .../home/opc/ but rather /sshx:oracle-root: like below. Running emacs -Q for emacs 27.2 (build 1, ....redhat): ~/.ssh $ cd /ssh:oracle-root:/ /ssh:oracle-root: $ pwd /ssh:oracle-root: /ssh:oracle-root: $ /bin/pwd / So what gives? submitted by /u/rdt-usr [link] [comments]

Is there any way to make src blocks readonly by default and only editable with org-edit-special? submitted by /u/clementjean [link] [comments]

_# org-roam joke incoming 😉 Like... look at the convoluted process I've resorted to. M-x org-roam-node-find Node: line-wrap :PROPERTIES: :ID: :END: #+title: line-wrap M-x visual-line-mode submitted by /u/ProbablyPuck [link] [comments]

Hello, everyone I recently started emacs and also made some settings on the basics of emacs, but as a programmer, it's not just text editing. I want to make my emacs a modern java development environment. My main language is java, but I use java. A When developing the springboot project, I encountered various problems such as not being able to run. I would like to ask you if anyone has experience in using emacs to develop springboot. Can you share your configuration? I really hope to get your help. submitted by /u/Capable-Mud-1918 [link] [comments]

submitted by /u/Apache-Pilot22 [link] [comments]

I own the purescript.io domain. I've had it for a few years and have never known what to do with it. It's up for renewal and I'm going to let it lapse. If someone wants it and has a productive use for it, DM me and I'll pass the ownership on. submitted by /u/noelmarkham [link] [comments]

Has anyone managed to configure the md4rd Reddit client library in Emacs? I’ve managed to configure my client ID, but I can’t understand how to handle the callback redirection - what web server is it performed on? https://github.com/ahungry/md4rd I appreciate any guidance submitted by /u/samuelmesa [link] [comments]

I was wondering if there is a setting somewhere that would allow org babel to correctly tangle a file when you have different parts of a class in different code blocks. I try and do something like this: # -*- org-src-preserve-indentation: t -*- Here's the first title +BEGIN_SRC python :tangle "foo.py" :mkdirp yes :comments link class foo: def bar(self) print("hi")\ +END_SRC Here's a title #+BEGIN_SRC python :tangle "foo.py" :mkdirp yes :comments link def func(self): print("bye") +END_SRC The code that gets generated looks like this: class foo: def bar(self) print("hi") def func(self): print("bye") Which obviously breaks the code since the definition of the second method is not properly indented. I have tried the options to preserve spacing but it doesn't seem to be working as expected. Is this a bug or am I mising a parameter to handle situations like this? submitted by /u/saltwaterflyguy [link] [comments]

For a long time I didn't know, that org-mode also supports backlinks. I searched for it yesterday, on a whim to make a text document more navigable and found it in the documentation: https://orgmode.org/guide/Hyperlinks.html#Internal-links-1 What I do with this is, that I have a heading "Remarks" for example and under that heading I have multiple lower level headings, one for each remark I have. Then in the rest of the document I can link to those remark headings using the usual links (org-store-link and org-insert-link) to headings and for each link to a heading, a target for a backlink, using the > syntax. Under each remark heading, I put a backlink, linking back to the target. That way I can have something like footnotes, but more flexible in how it can be used. I can use that for remarks, but also for other annotations. submitted by /u/zelphirkaltstahl [link] [comments]

I’m learning Haskell and stumbled upon “The Haskell School of Expression” by the late Paul Hudak . This is easily one of the best computer language books I have in my collection ) . I love his writing style , the design of the book ( including the type) and the use of graphics/multimedia to teach features of the language. 🍬👍👍👍 submitted by /u/964racer [link] [comments]

https://github.com/grin-compiler/grin/issues/132 Anybody interested in working on the haskell ( stg to be precise ) to GRIN translator, code gen, rts or just giving advice? submitted by /u/GunpowderGuy [link] [comments]

Hi, I'm currently playing with Haskell on Arch (with Doomemacs as IDE), and pretty happy with how everything is working. But i would like to try other distro (just for fun and to have some wayland experience), what is your haskell experience with more "esoteric" distro, like Void, Guix etc, so not usual Debian / Arch based stuff? submitted by /u/Tempus_Nemini [link] [comments]

I came accross Traversable, and specifically the definition of two functions for them. haskell traverse :: (Traversable t, Applicative f) => (a -> f b) -> t a -> f (t b) sequenceA :: (Traversable t, Applicative f) => t (f a) -> f (t a) on their own they look very interesting, sequence "inverts" nested functors, taking Just [1,2,3] to [Just 1, Just 2, Just 3]. Traverse looks like it does something similar with an extra step before. Not only that, but it looks really similar to a monadic bind, and vaguely looks like some of the type signatures inside Adjoint (which i have a loose understanding of... but not super solid, or rigourous). IO is an applicative thing, so this seems like a really clean way to get an IO of something (like a file path), and spit out a list of IO things to perform (like a list of file reads). But how does this generalize? i.e: what does flipping a traversable with an applicative have to do with actually traversing thorugh a functor?, or folding it together? I noticed most of the implementations of Traversable were monoids (like lists, first, sum, etc), which feels very relevant. How does one arrive at traverse?, with its specific definition pertaining to Applicatives. Is there a nice motivating example? What does Traversable have to do with Foldable? submitted by /u/cottonflowers [link] [comments]

submitted by /u/abhin4v [link] [comments]

Welcome to another issue of Haskell Weekly! Haskell is a safe, purely functional programming language with a fast, concurrent runtime. This is a weekly summary of what’s going on in its community. Featured Bluefin prevents handles leaking by Tom Ellis Haskell’s System.IO.withFile has a nice resource safety property. It also has a problem which its Bluefin equivalent fixes. Let’s have a look. Going REPLing with Haskeline by Abhinav Sarkar So you went ahead and created a new programming language, with an AST, a parser, and an interpreter. And now you hate how you have to write the programs in your new language in files to run them? You need a REPL! In this post, we’ll create a shiny REPL with lots of nice features using the Haskeline library to go along with your new PL that you implemented …  ( 2 min )

I'm working on a project where I'm using a Haskell library from Rust, and I'm wondering how exactly hs_init will modify its arguments. The GHC documentation says hs_init separates out the RTS options from the other command line arguments, and its arguments are int *argc and char ***argv. If it removes some of the arguments, its obvious that it would write a new int value to the location pointed to by *argc, but would it recreate the **argv array entirely and allocate new strings and write a new pointer to the location pointed to by ***argv? Or would it delete some pointers in the existing **argv array, and move pointers backward? If it creates a new **argv array with new strings, how do I free it when I'm done using it? In other words, I have a C function that just wraps hs_init, and I define it in Rust as follows: fn myproject_init(argc: *mut c_int, argv: *mut *const *const c_char) > c_void; Is this correct? submitted by /u/emassey0135 [link] [comments]

The guards I previously knew were just fancy if-else statements. Now I'm being introduced to guard() for list monads. It's super confusing that they have such similar names. I tried completing an assignment thinking I just had to use if-else statements, but guess what, the assignment required guard() for list monads. Well, at least I learned something new. But what is the idea behind naming them so similarly? submitted by /u/SpyX2 [link] [comments]

I'm pretty keen to work with Haskell in the real world, and was hoping someone here could guide me to an internship opportunity that is either global, or in Australia. Thanks for any help :) submitted by /u/how_to_not_reddit [link] [comments]

Copilot is a stream-based DSL for writing and monitoring embedded C programs, with an emphasis on correctness and hard realtime requirements. Copilot is typically used as a high-level runtime verification framework, and supports temporal logic (LTL, PTLTL and MTL), clocks and voting algorithms. Among others, Copilot has been used at the Safety Critical Avionics Systems Branch of NASA Langley Research Center for monitoring test flights of drones. I'm really, really happy to say that the Copilot project will being accepting contributions from community members again. Note: Contributors will be asked to sign a Contributor License Agreement, simply so that we can redistribute Copilot with their changes. I've opened a thread to talk about issues that community contributors could help with. If you've been following Copilot and have ideas to suggest, please add them here: https://github.com/Copilot-Language/copilot/discussions/557 Happy Haskelling! submitted by /u/ivanpd [link] [comments]

submitted by /u/n00bomb [link] [comments]

Here it is - the latest edition of the Scalendar newsletter. This month is packed with plenty of Scala meetups, so don’t miss out! ;) Take a look here: https://scalac.io/blog/scalendar-november-2024/ P.S. If you're looking for new growth opportunities and exciting projects in Scala... Scalac is currently recruiting ;) You can find the latest job openings at the end of the Scalendar and on our website in the careers section. submitted by /u/ComprehensiveSell578 [link] [comments]

submitted by /u/kosakgroove [link] [comments]

The perspective package has been updated to version 20241030.1848.

The icl-mode package has been updated to version 20241030.1743.

The stimmung-themes package has been updated to version 20241030.823.

The tok-theme package has been updated to version 20241030.609.

The rmsbolt package has been updated to version 20241030.607.

The copyit package has been updated to version 20241030.543.

The coc-dc package has been updated to version 20241030.455.

The w3m package has been updated to version 20241030.52.

The auto-virtualenv package has been updated to version 20241030.44.

Hi everyone! I’m not sure if anyone else is in a similar situation to me and may be able to help but I figured I’d post about it here anyways. The company that I work for has pretty much mandated that all engineers need to use Codeium on a daily basis. It’s not a suggestion it’s now a requirement. The Emacs package for Codeium, found here: https://github.com/Exafunction/codeium.el is honestly pretty bad. It takes a really really long time to give suggestions and frankly the ones it does suggest are pretty worthless because I can type it faster. At this point I’m either going to switch editors, which I don’t want to do because I’m the most productive in Emacs and have used it for over 6 years now. Or, spend some time outside of work trying to improve this package and make it work. Has anyone used this package and gotten it to work well? If so can you share some tips / code snippets of what worked for you? submitted by /u/LegO_Grievous__ [link] [comments]

For reasons that I can't quite explain, I am trying to add an entry manually to my Elfeed database. I have backed the database up already and I recognize the risks here. I wasn't sure how to do this, and found elfeed-db-add which takes an entry as an argument. Looking at some of the entries in elfeed-search-mode, I've created a test entry in the form of a hashlist as follows: (setq my_test_entry #s(elfeed-entry :id ("foo.com" . "https://foo.com/new_entry123") :title "A Test Elfeed Entry" :link "https://foo.com/new_entry123" :date 1720805386.0 :content #s(elfeed-ref :id "2ef7bde608ce5404e97d5f042f95f89f1c232871") :content-type html :tags (blogs unread) :feed-id "https://foo.com/feed" :meta (:authors ((:name "Foo McFoo")) ) ) ) But doing (elfeed-db-add my_test_entry) doesn't work -- it fails when trying to read the "id" of the entry. Is there something I'm doing obviously wrong? Is there a better way to do this (if it is possible at all)? Thanks in advance. submitted by /u/nonreligious2 [link] [comments]

Hi all, Recently I've been learning the built-in python-mode for my python needs and noticed that there is an automatic popup of function documentation in the minibuffer when my cursor is over the function. I've not made any config changes related to python-mode in my init.el. How do I disable this feature? I wish to load it on demand with C-c C-f or C-c C-d instead. Thanks in advance! submitted by /u/kn0xchad [link] [comments]

I finally managed to write the 3rd post of the short series Playing Hansel and Gretel with Marks, Registers and Bookmarks, this time covering bookmarks: https://arialdomartini.github.io/emacs-bookmarks This series is a revisited collection of the notes I took during my lessons with Protesilaos. submitted by /u/jeenajeena [link] [comments]

So, when dealing with embedded systems, firmware, etc., I end up looking at a lot of binary files in Emacs. hexl-mode is basic but good and I've made good use of it. However, there's a few things more that I need and I'm hoping an elisp expert might be able to point out a solution. So first, the binary data I'm dealing with is little endian. Thus it's a little hard to just look at the hex values and mentally reverse them byte for byte. In order to save myself writing down a lot of numbers, I coaxed Copilot into helping make a function that will take the region I mark, remove the spaces, reverse the characters in pairs. This works really great, and the code is here for reference: hexl-functions.el However it has a problem when a region spans rows like this: hexl-mode w/ region spanning ro…

i want my space to act like space when no other key is pressed along with it but when i press my space with any other key i want it to work like meta key with the other key as the commbination submitted by /u/GiGaBIT_username [link] [comments]

Or is there a better read for a noob wanting to adopt Emacs for everything ? submitted by /u/ll777 [link] [comments]

This is a thread for smaller, miscellaneous items that might not warrant a full post on their own. See this search for previous "Weekly Tips, Tricks, &c." Threads. Don't feel constrained in regards to what you post, just keep your post vaguely, generally on the topic of emacs. submitted by /u/AutoModerator [link] [comments]

submitted by /u/github-alphapapa [link] [comments]

[SOLVED] org-agenda-prefix-format %b Let's say my agenda file looks like this: * Tasks ** TODO Project XPTO [1/10] *** TODO [#B] read docs *** ... My agenda view filtered by priority B would look like this: TODO [#B] read docs Which gives me no context about what project its associated. Is there a property to show TODOs like this or similar? TODO Project XPTO [1/10] > [#B] read docs I couldn't find another post about that, but I'm sure someone asked something similar submitted by /u/AkaIgor [link] [comments]

I'm starting out in org mode. I want a daily notes set up in a similar format to Logseq/Roam. I also find use in the agenda/Todo functionality, using quick capture to add scheduled events and todos. My problem is I've used chatgpt to tell me how to configure all this, and it just can't do it properly. Has someone got an .emacs file I can use which will do what I want? submitted by /u/LengthinessQuick125 [link] [comments]

So i am using org and calfw. I have two types of reminders that I use (and a capture template for both); recurring and 1 off. 1 off reminders set the date for the heading in org's normal format and show up without issue. I can even do two dates seperated by -- and they show up as a span. That is great. The problem is my recurring items do not show up. I'm certain this is becuase of the formatting: Any ideas on how to solve this so that these recurring items show up? In the interium i'm manually adding an entry but I get double entries on my normal agenda. submitted by /u/timmymayes [link] [comments]

OK this is a relatively small thing, but I am working on the course materials for the course I am teaching, and one thing that irks me is how the code block (exported using the `engraved` backend) exports in a different size than the output (large, black-color monospaced text) of same code block. Is there any way to make sure the code block and the output are consistent in terms of font size? Screenshot of the current PDF output of my org text. I want the code block output to have the same size as the code block itself. submitted by /u/thriveth [link] [comments]

In my work we usually develop features for clients with schedules and deadlines based on weeks. So in the contract we say we will start doing Feature XYZ at the week 1 of september and it will be ready until week 3 of october. Of course, I could schedule the taks to september 1st and put a deadline to october 15th, but this would only remind me about the task when I am near the schedule or deadline. The interval in between for regular agenda views would be empty. And I could also break the task in a bunch of subtasks and select a time slice for each. But anyways it's not so clear to me what tasks me and my colleagues should be focused. Its not easy to tell if this week is very busy because we have a bunch of features to develop in parallel, and next week we would have more time because there are less features to develop. Some people recommend me to use gantt graphs and I really liked the idea. I just wanted to know if you have any other suggestions for handling such type of tasks that span multiple weeks, when you have multiple of them in parallel. submitted by /u/AkaIgor [link] [comments]

I have forever wanted to have my own custom section in the agenda where I can put whatever I feel like instead of the generated by scanning the agenda files only. So I did a bit of research and was able to successfully do it. There is not much info about it, thus I have created a simple example if anybody is interested. Currently I am using it to query directly the org-roam database for specific nodes that I want to display. it works beautifully. No need to have the org-files open any more. https://gist.github.com/dmgerman/b75dd1c68636482121b3491e0b351f17 submitted by /u/dm_g [link] [comments]

So far I have been using C-c then easily remember letters. Is there a more proper way to go about this? submitted by /u/Firm_Evening_8731 [link] [comments]

submitted by /u/jamescherti [link] [comments]

not a very important post haha, but i have recently completed the Emacs tutorial and i have never seen such user-friendly and great documentation for beginners. it's given me lots and lots of confidence to continue the Emacs way, and i'm very happy right now so, from the bottom of my heart, thank you for Emacs and for this tutorial. it may seem silly, but again this has been one of the best tutorials i have seen in my life, not exxagerating cheers, train your emacs-fu people <3 PS : it does make me wish we had this sort of tutorial for stuff like tiling WMs 😇 submitted by /u/arni_ca [link] [comments]

submitted by /u/thriveth [link] [comments]

https://preview.redd.it/otxt90p4epxd1.png?width=1837&format=png&auto=webp&s=7d5001629cb77af941066aa6bf0509b38b8f1e8f With color-emoji support. src: https://github.com/emacs-mirror/emacs/commit/edf37e811cafa4092b13969613fa83f6e6d69ab3 submitted by /u/harunokashiwa [link] [comments]

Without using the mouse, how do I "select" an item in the xref buffer? submitted by /u/BuilderMax21 [link] [comments]

I'm working on a huge project and helm-projectile-find-file delays for 1-2 secs before printing the files tree Is there a way to speed it up? I was thinking maybe there's a way to change the backend to fzf somehow, haven't found any solutions though I was also thinking about playing with projectile caching, but from what I understood cache invalidation might be a problem resulting in unwanted behaviour Profiler ``` 423,430,216 99% - command-execute 423,430,216 99% - funcall-interactively 330,351,405 77% - helm-projectile-find-file 330,287,309 77% - helm 330,284,213 77% - helm 330,284,213 77% - helm-internal 324,952,212 76% - helm-read-from-minibuffer 221,212,085 52% - helm-update 219,426,009 51% - helm--collect-matches 219,426,009 51% - helm-compute-matches 219,399,929 51% - helm-get-cached-candidates 219,399,929 51% - helm-get-candidates 219,399,929 51% - helm-interpret-value 219,399,929 51% - helm-apply-functions-from-source 218,351,321 51% + # 17,632 0% + helm-process-filtered-candidate-transformer 8,448 0% + helm-take 641,448 0% + helm-render-source 573,342 0% + helm--update-move-first-line 568,190 0% + # 3,096 0% + helm-update-source-p 100,792,576 23% + timer-event-handler 2,030,950 0% + redisplay_internal (C function) 203,959 0% + command-execute 53,552 0% + helm--update-header-line 39,930 0% + minibuffer-setup 12,104 0% + minibuffer-inactive-mode 7,600 0% + highlight-parentheses--initiate-highlight 6,762 0% + minibuffer-setup 6,512 0% + minibuffer-mode 6,480 0% + highlight-parentheses-minibuffer-setup 4,096 0% + thing-at-point 3,096 0% + winum--update 2,112 0% + helm-get-candidate-number 2,112 0% + winner-save-unconditionally 1,056 0% + global-spacemacs-leader-override-mode-check-buffers 1,056 0% + evil-mode-check-buffers 1,056 0% + global-origami-mode-check-buffers 1,056 0% + yas-global-mode-check-buffers 48 0% + run-hooks ``` Thanks for your tips in advance submitted by /u/Atagor [link] [comments]

submitted by /u/cofix42 [link] [comments]

Hi, I'm running into a problem where the find-name-dired command doesn't display unicode characters correctly, and attempting to open a result crashes emacs. An example result: 9054285 0 -rw-r--r-- 1 user user 0 Oct 29 09:14 \343\201\223\343\202\223\343\201\260\343\202\223\343\201\257.txt I did some digging and found out this is because of the "-ls" command supplied to find, which escapes all "unusual characters". Command used by emacs: find . \( -name \* \) -ls Does anyone have any solutions for this? Thanks in advance. submitted by /u/agilefishy [link] [comments]

I can't for the life of me succeed with a org-ql query involving properties. Running Emacs 29.4 (Ubuntu WSL) I have a collection of files where each file represents a contact with the following properties: :PROPERTIES: :type: contact :sub_type: person :organization: [Company : Department] :name: Name Familyname :position: CEO :tel_work: :tel_home: :tel_mobile: :ID: someIdHere :ROAM_ALIASES: Name :END: #+title: Name Familyname #+BEGIN: org-ql :query (property "type" "contact") :columns ((property "type") (property "name")) #+END: I get nothing in return. submitted by /u/RoInRo [link] [comments]

submitted by /u/geospeck [link] [comments]

There is this switch in ls, -D or --dired for long, the manual says it's gonna output some informations, so dired can more easily parse the result. Does it really make a difference? Or it's just purely left there for legacy reasons? submitted by /u/funk443 [link] [comments]

Clash of IO, background removed using AI 🎉🎉 Adam Hearn is joining us next week, to teach us about Kyo with a Talk + Workshop 🎉🎉 Plenty of thanks to Kyo's contributors, we might be the first Scala conference to have a presentation on Kyo! https://scala.io/sessions/paris-2024/building-robust-applications-with-kyo-intro https://scala.io/sessions/paris-2024/building-robust-applications-with-kyo You can get tickets directly here : https://scala.io --- Effect systems have been a major subject in the community, for the past 10 years, especially for the past 6 years, we had the chance to have great speakers on the matter to share they thought about it. We keep this playlist updated : https://www.youtube.com/playlist?list=PLjkHSzY9VuL8wHLPlQIx0QnbFSHHqF8gB It's a pleasure to have Kyo at the conference, reinforcing our mission to create a welcoming space where Scala enthusiasts can share ideas, even when they differ. After featuring Ox in February and more ZIO content in 2022, the clash of IO a couple of years ago, a joint talk on "Performance and Compatibility Hybrids Kyo/Ox/Caprese Apps on the JVM" next year would be fantastic! submitted by /u/ahoy_jon [link] [comments]

I've got some issues with Pekko code and I believe it's related to the fact that the default Flow already materializes the data: ``` def addSha(request: HttpRequest)(using as: ActorSystem[Any], ec: ExecutionContext ): Future[HttpResponse] = request.entity.dataBytes .via(computeHashWithPayloadAndPayloadLength) .map { out => request .withEntity(out._2) .addHeader(new RawHeader("sha", out._1.digest().map("%02x".format(_)).mkString)) } .via(Http().outgoingConnection) .runWith(Sink.head) private def computeHashWithPayloadAndPayloadLength: Flow[ByteString, (MessageDigest, ByteString, Int), NotUsed] = Flow[ByteString].fold((MessageDigest.getInstance("SHA-256"), ByteString.empty, 0)) { (acc, chunk) => acc._1.update(chunk.toByteBuffer) (acc._1, acc._2 ++ chunk, acc._3 + chunk.length) } ``` Basically I need the request body in order to compute an hash and add it to the headers, forcing me to consume the source. If I comment this line ```//.withEntity(out._2)``` it returns the error: > substream source cannot be materialized more than once because the flow I'm using is the default Pekko Http one (Http().outgoingConnection) and it seems to materialize the data. By using the .withEntity I'm creating another entity stream that can then be consumed another time. Now onto my question: is there any way to solve this (maybe by using another pekko http flow) without having to re-implement the Http().outgoingConnection with the hash computing part? submitted by /u/Defiant_Fix_9753 [link] [comments]

Hi everyone, could someone here maybe help me? I can not understand why this code throws a NullPointerException in the println: import java.util.HashMap; class Main { def main() { val map = new HashMap(); val nullobj = map.get("foo"); println(nullobj == null) } } This seems to somehow be an issue with the type inference: The type gets inferred as `Nothing` and specifying any other type for `nullobj` makes the code work. Thanks in advance! submitted by /u/Doctorados [link] [comments]

Hey there I'm a software engineer mostly using C#/.NET for backend services and I've been interested in distributed systems for a while. Obviously going down the rabbit hole of dist sys, one comes across functional programming languages, concurrency models, BEAM, Go, Actor model etc. While I do like Go and Elixir, job prospects where I live don't offer that many roles using those technologies. There are however a fair amount of Scala roles where I live, and I know Scala + Akka also used to build scalable and fault-tolerant systems (Twitter/X being a major example). I would be keen to enter a backend role using Scala but I am just wondering about the Scala ecosystem. The problem I have with the .NET ecosystem, is that it is a rather boring ecosystem outside of Microsoft's technologies. Want an ORM? Use Entity Framework Core. Want a SQL DB? Use Microsoft SQL Server. Want a NoSQL DB? Use Azure Cosmos DB. Yes there are a lot of alternatives, but they are few and far between, enterprises would rather just stick to Microsoft's solutions and the open source ecosystem is very limited. Is this similar with regards to the Scala ecosystem? Would you recommend going into Scala? Any advice would be appreciated :) submitted by /u/MinMaxDev [link] [comments]

submitted by /u/Hefty-Necessary7621 [link] [comments]

I'm working through the Liquid Haskell tutorial and I'm running into an error where twoLangs does not seem to be matching the inferred type. This is copied directly from the documentation, which seems a little outdated {-# OPTIONS_GHC -fplugin=LiquidHaskell #-} {-@ LIQUID "--no-termination" @-} module Main where import Data.Vector {-@ type VectorN a N = {v:Vector a | len v == N} @-} {-@ twoLangs :: VectorN String 2 @-} twoLangs = fromList ["haskell", "javascript"] -- Error here main :: IO () main = putStrLn "Hello, Haskell!" ------------------------------------------------------- **** LIQUID: UNSAFE ************************************************************ app/Main.hs:17:1: error: Liquid Type Mismatch . The inferred type VV : (Data.Vector.Vector [GHC.Types.Char]) . is not a subtype of the required type VV : {VV##1376 : (Data.Vector.Vector [GHC.Types.Char]) | len VV##1376 == 2} . Constraint id 15 | 17 | twoLangs = fromList ["haskell", "javascript"] Any ideas what went wrong here? submitted by /u/Accurate_Koala_4698 [link] [comments]

Why use Haskell? submitted by /u/ahamharu [link] [comments]

In the paper Profiling Optimised Haskell: Causal Analysis and Implementation by Peter Moritz Wortmann, there's discussion about an experimental .debug_ghc section which contains additional DWARF metadata in ELF files (p.156). Does anyone know what happened to this ELF section? I could find some discussion about the proposal in the GHC-Devs email archives [1, 2], but no resolution. I've not been able to generate it--the closest I could generate was .debug-ghc-link-info, which I assume helps generate the _info debug annotations. (this is generated with ghc -g fairly easily) I'm not sure what exactly is in .debug-ghc-link-info, so maybe it contains the same info that would have been in .debug_ghc anyways. Any help here would be appreciated to further my research! EDIT: .debug-ghc-link-info is NOT used for the _info debug annotations. It's just used to determine whether to relink. See comment. So the original question stands. submitted by /u/CrystalLord [link] [comments]

The flycheck-hledger package has been updated to version 20241029.1710.

The focus package has been updated to version 20241029.1506.

The no-littering package has been updated to version 20241029.1402.

The consult-todo package has been updated to version 20241029.409.

The coercion package has been updated to version 20241029.401.

The duplexer package has been updated to version 20241029.356.

The binky package has been updated to version 20241029.355.

The fountain-mode package has been updated to version 20241029.303.

The gptel package has been updated to version 20241029.205.

The llama package has been updated to version 20241029.103.

submitted by /u/sridcaca [link] [comments]

Question is simple. What's wrong with it? We have 9.10.1 that was released at 10 May 2024 We have 9.6.6 that was released at 1 July 2024 And now we have 9.8.3 Why versions are not incremental. Am I missed something? Is it somehow related to LTS versions or something? Could, someone, help me understand it? Thanks in advance submitted by /u/Interesting-Pack-814 [link] [comments]

Hi, i'm getting a mistake when i press Tab in process of autocompletion (see below). I have more or less standard setup: - doomemacs: in init.el i uncommented lines with lsp and haskell +lsp, in packages.el i added lsp-haskell and haskell-mode (and ormolu, but i don't thinks this one is relevant in my case) - ghc tools installed with ghcup: ghc version 9.10.1 and HLS verions 2.9.0 Here is an error message Error processing message (error "No plugins are available to handle this SMethod_CompletionItemResolve request. Plugins installed for this method, but not available to handle this request are: ghcide-completions does not handle resolve requests for ghcide-completions: error decoding payload:expected Bool, but encountered Null)."). Any ideas how i can get rid off those? Not that a big deal, but it's quite annoying. submitted by /u/Tempus_Nemini [link] [comments]

As a very occasional Haskell developer, I'm wondering what's the state of the art in effect management these days. What things is the legacy now? What is the future? I personally used only the first three. View Poll submitted by /u/MysteriousGenius [link] [comments]

submitted by /u/tomejaguar [link] [comments]

Finally, we are announcing it, due to the organization of an indie conference, it always takes more time to communicate! Valentin Kasas, that some of you know from the previous edition of the conference in Lyon, is coming back from under his rock to open our conference. Valentin, true to his name, will talk about our specific subject of interest, Scala, with a dash of Love. Where to watch it? All the talks are free on YouTube 1 or 2 months after the conference on this channel: https://www.youtube.com/@scalaio (you can subscribe). You can support us directly by buying streaming access to the conference on our website for €85 (2 days of conference, 2 tracks) : scala.io Can't wait to open the door of the conference next week! https://scala.io/sessions/paris-2024/surprise-opening-keynote submitted by /u/ahoy_jon [link] [comments]

submitted by /u/philip_schwarz [link] [comments]

I take a look at what typeclasses are, how we can use them in Java, why nobody does and why they are so prevalent in Scala. https://www.youtube.com/watch?v=VDSWjHgM5HA submitted by /u/arturaz [link] [comments]

submitted by /u/baldingbryan [link] [comments]

This sounds simple, but I can't seem to serve static files from ZIO. I literally copied code from the documentation import zio._ import zio.http._ object StaticFiles extends ZIOAppDefault { /** * Creates an HTTP app that only serves static files from resources via * "/static". For paths other than the resources directory, see * [[zio.http.Middleware.serveDirectory]]. */ val routes = Routes.empty @@ Middleware.serveResources(Path.empty / "static") override def run = Server.serve(routes).provide(Server.default) } And put a file.js in src/main/resources/file.js But when I access localhost:8080/static/file.js it returns a 404. submitted by /u/steerflesh [link] [comments]

submitted by /u/eed3si9n [link] [comments]

submitted by /u/lihaoyi [link] [comments]

The treemacs package has been updated to version 20241028.2122.

The dumber-jump package has been updated to version 20241028.1822.

The citre package has been updated to version 20241028.1548.

The phpstan package has been updated to version 20241028.1536.

The color-theme-sanityinc-tomorrow package has been updated to version 20241028.1458.

The org-upcoming-modeline package has been updated to version 20241028.1217.

The mugur package has been updated to version 20241028.828.

The hyperbole package has been updated to version 20241028.551.

The org-link-beautify package has been updated to version 20241028.421.

The switch-window package has been updated to version 20241028.314.

The helm-ag package has been updated to version 20241028.144.

The better-defaults package has been updated to version 20241028.4.

Hello everyone, has anyone a solution or package to perform textual generative response from personal notes? submitted by /u/New_Book9671 [link] [comments]

I'm new to Emacs. I use Doom Emacs and I wanted to know what the workflow is supposed to look like? How do you start up the dev server and Tailwind support? submitted by /u/KaladinThunder [link] [comments]

I'm at a loss for why I can't get tree-sitter to work. Whenever I fire up emacs, I get the folllowing error message: ⛔ Warning (treesit): The installed language grammar for gleam cannot be located or has problems (not-found): (libtree-sitter-gleam.so libtree-sitter-gleam.so.0 libtree-sitter-gleam.so.0.0 libtree-sitter-gleam.dylib libtree-sitter-gleam.dylib.0 libtree-sitter-gleam.dylib.0.0) No such file or directory But I've gone and double checked that /tree-sitter/libtree-sitter-gleam.dylib absolutely does exist. Why is tree-sitter not seeing the library that is definitely there? Is there a way to check that it's looking in the right directory? I don't think this is the problem, but I've made sure that (treesit-available-p) does evaluate to t. submitted by /u/lubed_up_devito [link] [comments]

Config: ``` (use-package nov :config (setq nov-text-width 80 shr-use-css nil) ;; Disable external CSS to allow Emacs faces to take precedence ;; Customize faces for code rendering (defun my-nov-setup-shr-styles () "Customize faces for code blocks and inline code in nov.el." ;; Set monospace font and dark background for inline code (set-face-attribute 'shr-code nil :family "Courier New" ;; Preferred monospace font :background "#333333" ;; Dark background :foreground "#E5E5E5" ;; Light foreground :weight 'normal) ;; Set monospace font and dark background for block code (set-face-attribute 'shr-tag-pre nil :family "Courier New" ;; Monospace font for block code :background "#333333" ;; Dark background for block code :foreground "#E5E5E5" ;; Light foreground :weight 'normal :height 1.0) ;; Adj…

I have been progressing through my emacs journey and have hit a bit of a pain point with my org mode setup. I have read conflicting opinions on how to handle it so I'm reaching out for some pointers. In org mode I have noticed that the soft line wraps I have in code do not apply. After some reading, it seems there is visual-line-mode and hard indentation available to handle this. What is the consensus to the best solution? Some comments have mentioned that hard indents break org files when viewed on smaller devices. I find it odd to keep everything on one line personally. In my coding I'm used to breaking lines at 80 or 100 columns, but again this doesn't seem to apply in org mode and I am struggling to get the correct config. Lastly, I have not been successful in my attempts to get 1.25 or 1.5 line spacing in org mode. Is there a correct way to do this as sometimes I feel all the lines of text are more squished together then when looking at code. submitted by /u/BinaryBitsOfFury [link] [comments]

Just (use-package eat) feels rather spartan. submitted by /u/vfclists [link] [comments]

submitted by /u/AndreaSomePostfix [link] [comments]

submitted by /u/ergopractice [link] [comments]

Totally new to emacs, termux, and all of this stuff. Just thought it would be cool to learn sbcl on my tablet and emacs seems to be the best way to do it... I installed both Termux and Emacs from sourceforge and gained super user permission for both apps. Emacs seems to be finding sbcl but thats as close as I get. I followed the sourceforge doc that tells you go ahead and put some lines in early-init.el (also tried .emacs.d/early-init.el) but as far as I can tell that doesn't seem to have any real effect on the outcome. The .emacs file seems to be working though. Like the changes I made there are changing my errors (mostly just whether it says "no such file or directory, lisp". Or "no such file or directory, sbcl". Or if it finds sbcl and then gives me an error lol.) In case it matters …

I found out that with about 20 lines of elisp I could replace org-alert and org-wild-notifier for my needs, and it works very well. I haven't found any examples of people using appt to show desktop notifications, and that was something I really needed, so I decided to write an article for anyone that had this same need. I've been using Emacs for about 6 months, so probably this is not the best solution, so feel free to give feedback :) https://igormelo.org/you_dont_need_org_alert.html submitted by /u/AkaIgor [link] [comments]

I can't figure out why I can't rename symbols project-wide with eglot. The eglot-rename command works but only if I have all files containing that particular symbol already opened. Is this normal behavior? I would like to rename all symbols in the current project. I don't have any particular configuration, just eglot-ensure on c-mode-hook. I am using clangd for my C project. submitted by /u/ismbks [link] [comments]

Hi Emacs and emacs-eat enthusiasts: I am trying to find the commands that I can put in my .emacs file so that the eat terminal emulator will startup in line mode. Here are two approaches I've tried: (eval-after-load "eat" '(progn (eat-line-mode) )) And: (add-hook 'eat-mode-hook 'eat-line-mode) If you could teach me how to do this correctly, I would be most appreciative. All the best, CS submitted by /u/-CindySherman- [link] [comments]

Hi, I was wondering if anyone can help. Up until a couple of days ago I was happily using c-u 6 c-x ^ to enlarge the active window. This does not work anymore and I get the message Cannot enlarge selected window. A search online only brings up only 3 results from 2016 which seem to refer to messages from gnu mailing lists re this issue. I don't remember doing anything sinister with my .init file 2 days ago to have this behaviour. Any help/advice? https://preview.redd.it/599xc41ww9xd1.png?width=536&format=png&auto=webp&s=53cb20d320e3756cea14da0dc1c23645b50bcd95 Thanks EDIT: Solution given by u/Hungry-Percentage-23 Use of M-x enlarge-window-horizontally or c-u 6 c-x } for me submitted by /u/_rt_io [link] [comments]

I have recompiled all Emacs packages using 'package-recompile-all' on two machines and on both occasions received the following error message: Error running timer 'idlwave-load-rinfo-next-step': (error "No such XML routine info file: /path/to/current-directory/@@@@@@@@/help/idl_catalog.xml") Searching this error hasn't come up with anything I could find useful. Does anyone have any ideas as to what's causing this and a possible remedy? submitted by /u/taeknibunadur [link] [comments]

https://preview.redd.it/qda1duupq8xd1.jpg?width=413&format=pjpg&auto=webp&s=d484461bc542c3fe8688be7a88d2acc74bc9289a https://preview.redd.it/d8ftahdrq8xd1.jpg?width=282&format=pjpg&auto=webp&s=852c2b2e25ad9abf4118379e58dea64941015474 My font settings: (set-face-attribute 'default nil :family "Iosevka Extended" :height 100 :weight 'semibold) Can I make the blocked faces (e.g., TODO, timestamps, tags) a bit bigger? They are smaller than they should be. Thank you in advance! submitted by /u/Hungry-Percentage-23 [link] [comments]

Hi Config Masters, I have been using Emacs at work. My workflow involves logging in to remote servers to edit files there, compile code, deploy etc etc.. Dired, (multi)vterm, tramp, project.el are my best friends. However, when I close my laptop, all my remote commands running on remote servers stops as the ssh pipe breaks. I am looking for an option to sort of configuring my office laptop as a central hub where I can start and connect to persistent session running on remote machine(s). And no, I do not want to have a Emacs deamon running on remote servers. Basically, I am looking for someone like tmux, screen client that I can start and connect to subsequently on those remote machines from my local emacs. Any suggestions? submitted by /u/Eclectic-jellyfish [link] [comments]

I have been working on a PR for Scala Metals recently. I use Emacs, so I ended up adding an utility to quickly refresh the Metals snapshot to test my latest changes. I wrote about it here, if anybody else uses that editor: https://ag91.github.io/blog/2024/10/27/tips-to-contribute-to-scala-metals-lsp-server-with-emacs/ Also not sure if it would be of interest to write down how adding a Code Action to Metals works for potential future contributors? submitted by /u/AndreaSomePostfix [link] [comments]

submitted by /u/petrzapletal [link] [comments]

Here are results of benchmarks for jsoniter-scala Vs simdjson-java (parsing of different sizes of strings and arrays of booleans and numbers, tested on JDK-24). TLDR: simdjson-java outperforms only in parsing of long ASCII strings: https://github.com/plokhotnyuk/jsoniter-scala/compare/master...simdjson#diff-f4916c36d9b86fe29ebd1ca34d19acb6b834dc1fecf5149c5cb319ee4bca2919R1 Also, simdjson-java is faster in skipping of JSON input that is not going to be decoded to some fields of resulting product-type instance: https://github.com/simdjson/simdjson-java?tab=readme-ov-file#512-bit-vectors When using Oracle GraalVM JDK results for jsoniter-scala are better at ~10%, but simdjson-java slows down in 100x times or more because incubating JDK extension for vectors is not supported in GraalVM yet. submitted by /u/plokhotnyuk [link] [comments]

enum Permission: case SuperUser extends Permission case Admin(organization: String) extends Permission given superUserEncoder: JsonEncoder[Permission.SuperUser.type] = ??? given adminEncoder: JsonEncoder[Permission.Admin.type] = ??? // No given instance of type zio.json.JsonEncoder[Permission] val p = Permission.SuperUser.toJson I want to use a different encoder depending on the enum type. How can I get this to work? submitted by /u/steerflesh [link] [comments]

enum TimeSpan: case All extends TimeSpan case Until(end: LocalDateTime) extends TimeSpan case InclusiveStartExlusiveEnd(start: LocalDateTime, end: LocalDateTime) extends TimeSpan I want to have something like this to validate the input before creating an instance of InclusiveStartExlusiveEnd object InclusiveStartExlusiveEnd: def apply( start: LocalDateTime, end: LocalDateTime ): Validated[String, InclusiveStartExlusiveEnd] = ??? Is it possible with the scala 3 enum syntax? submitted by /u/steerflesh [link] [comments]

Hi, I want to create a org mode doc like this: ``` * Lv1 text ** Lv2 text more text for Lv1 ``` However, org-mode thinks the last line in the example belongs to Lv2 and is folded when I try to fold Lv2. Is there a way to tell it where Lv2 ends? Thanks submitted by /u/davidshen84 [link] [comments]

submitted by /u/AkaIgor [link] [comments]

Hello, beginner here. I am having trouble wrapping my head around what's happening in the Haskell type system. I have created by own function composition function which behaves like (.) fcomp :: (b -> c) -> (a -> b) -> a -> c fcomp f g x = f (g x) Now, I could use a single argument function for f, and a single argument function for g. ghci> (+1) `fcomp` (+10) $ 100 111 HERE'S THE LAPSE IN UNDERSTANDING But I am instead using a two argument function for f. ghci> ((+) `fcomp` (+10)) 1 100 111 Notice how the function (+) being passed to fcomp has a different type signature. (+) has two inputs, (+) :: Num a => a -> a -> a, whereas in fcomp, the part of the type signature that should be receiving (+) is instead (b -> c) -- for one input. I tried reducing the above example with fcomp by hand. Here's what I have come up with; fcomp :: (b -> c) -> (a -> b) -> a -> c fcomp (+) (+10) 1 = (+) ((+10) 1) (partially applied) fcomp :: (b -> c) -> c = (+) (11) In (partially applied) fcomp, since we have (+) with type Num a => a -> a -> a, shouldn't the type signature remaining in (partially applied) fcomp be (b -> b2 -> c) -> c? Instead of (b -> c) -> c? And beyond this, since fcomp returns c, how can we even get a partially applied function back as a result for c? Wouldn't it break the type system to return a partially applied function for c? Thanks in advance! submitted by /u/laughinglemur1 [link] [comments]

So, I am aware that function composition in Haskell entails taking multiple partially functions which accept a single argument, and chaining them together. Just to illustrate visually, here's an example of the single-argument-functions being chained; Prelude> ( (+1) . (+1) ) 1 3 Now, I have noticed that it's possible to 'compose' a function which takes two arguments and a second function which takes a single argument, so long as a second parameter is passed to this resulting composed function. Here are two examples; Prelude> ( (+) . (+1) ) 100 10 111 Prelude> ( (++) . (++" ") ) "hello" "world!" "hello world" I would like to know what's going on here... seeing that the function composition operator is defined as (.) :: (b -> c) -> (a -> b) -> a -> c , wouldn't this logically mean that something like ( (+) . (+1) ) wouldn't even pass the type checker? I really don't understand what's going on with the function composition operator and how this is passable in the type system (as seen in the type declaration). Can someone explain what's happening? Thanks in advance! Note: Interestingly enough, I found that I can't use the function composition operator when both the first function and the second function each take two arguments. That is to say that the following doesn't function; Prelude> ( (+) . (+) ) 100 10 1 ERROR ... After further experimentation, I have notice that the second function (and likely the final function in the chain) must be one which takes a single argument. This is simply an observation -- the original questions still stand. submitted by /u/laughinglemur1 [link] [comments]

I recently installed a dev environment on Mac OS and windows to learn Haskell . I was looking for a similar experience to Visual studio with “intellisense” completion which is extremely useful in learning a new language or api . So I went down the path of installing ghcup and using stack and VS code with the HLS . So far so good. Not being familiar with any of these tools , I had some questions. 1) there are some glitches where it seems I have to kill VS and restart it to get HLS to work . It looks like stack downloads the version of compiler I want for a particular snapshot ( or resolver option) , does it download the correct HLS for that version ? - and also the VS Haskell plugin I assume doesn’t actually have HLS in it , it just interfaces with it . ( is that correct? ) 2) is a stack project a good way to learn the language? I’ve been modifying the default Lib.hs , Main.hs and using “stack ghci” to get a repl and load . Seems like a good way to approach it . The terminal in VS is nice . 3) I’m a graphics guy so my plan will be to bring in libraries / packages soon. For the moment I’m following a tutorial to build a lisp interpreter. Is stack, again , the right approach or should I learn about cabal ? Any comments on the learning path is appreciated. submitted by /u/964racer [link] [comments]

The big thing I wanted to get working was Monomer. I had trouble getting that to build and compile under stack, along with other GUI frameworks. After I heard that the old cabal problems were no more, I decided to bite the bullet and give it the "acid test". So I went back to my Haskell GUI project, and managed to get it to work. Monomer also has a lot of example code, and that now works gloriously. I am also impress with Monomer using mesa. Which is perfect for what I have in mind. I have another GUI project going on in C++ using GTK4, and it will be fun seeing how each framework stands up. I do have a question about Monomer. How portable is it? I imagine it will work on Macs, but will it work on Windows as well? submitted by /u/el_toro_2022 [link] [comments]

I’ve got a task that’s working through Haskell using JSON and using the equal function trying to implement and see wether or not 2 JSON objects are the same field or different if anyone can help submitted by /u/boyle60 [link] [comments]

The visual-replace package has been updated to version 20241027.1814.

The external-dict package has been updated to version 20241027.1721.

The logview package has been updated to version 20241027.1639.

The thrift package has been updated to version 20241027.1633.

The rutils package has been updated to version 20241027.1606.

The citar package has been updated to version 20241027.1331.

The grip-mode package has been updated to version 20241027.1320.

The dmacro package has been updated to version 20241027.830.

The org-timeblock package has been updated to version 20241027.805.

The scala-ts-mode package has been updated to version 20241027.701.

When in the Archive I select two or more notes, the right panel indicates the number of notes selected. But in Ulysses, the selected notes are concatened and displayed in order, and I can modify them and even export them as a whole (but I can't copy all notes together, that's the limit). For this, Ulysses allows the reordering of notes by drag and drop. This behavior is for me the most important strength of Ulysses, the main reason I'm using it for writing books and long articles. I imagine it would be very difficult (impossible?) to make The Archive behave this way, but do you know other Markdown editors doing it? (In Zettlr, it's not possible to select multiple notes, except at export and only if the folder has been declared as a project: far to be as intuitive and natural as in Ulysses).  ( 3 min )

I am just starting to explore this topic, but it seems there is a big overlap between org-collector and the standard Column Views (specifically the "capturing column view" part). Does anybody know the history of these features? Are they related? Is one strictly a superset, or do both have uses the other cannot cover? submitted by /u/bullpup1337 [link] [comments]

I am using Khalel a package for interacting through Emacs with locally-stored calendars via the console application khal and syncing with remote CalDAV calendars using vdirsyncer. When I use my custom capture template the khalel-add-capture-template stops working. Whesn I comment out my custom capture template the khalel-add-capture-template starts working again. I tried to add khalel-add-capture-template manually to my config, but it somehow hijacks so I just get "e" calendar event" and not the other three entries I want. Why does the Fleeting Note, Permanent Note and Task not show up? My full config.org is here for reference. ** Capture Templates #+begin_src emacs-lisp (use-package org :config :custom (org-goto-interface 'outline-path-completion) (org-capture-templates '(("e" "calendar event" entry #'khalel--make-temp-file "* %?\12SCHEDULED: %^T\12:PROPERTIES:\12:CREATED: %U\12:CALENDAR: \12:CATEGORY: event\12:LOCATION: \12:APPT_WARNTIME: 10\12:END:\12" ("" "" entry (file "~/Dropbox/Documents/notes/calendar.org")) "") ("f" "Fleeting note" item (file+headline org-default-notes-file "Notes") "- %?") ("p" "Permanent note" plain (file denote-last-path) #'denote-org-capture :no-save t :immediate-finish nil :kill-buffer t :jump-to-captured t) ("t" "New task" entry (file+headline org-default-note s-file "Tasks") "* TODO %i%?")))) #+end_src submitted by /u/MethAddictedMonkey [link] [comments]

The flymake-ansible-lint package has been updated to version 20241026.2053.

The elisa package has been updated to version 20241026.2047.

The finito package has been updated to version 20241026.1642.

The magit-gerrit package has been updated to version 20241026.1641.

The zig-ts-mode package has been updated to version 20241026.1427.

The project-tasks package has been updated to version 20241026.1414.

The dpkg-dev-el package has been updated to version 20241026.627.

The debian-el package has been updated to version 20241026.559.

The eldoc-box package has been updated to version 20241026.259.

submitted by /u/mmontone [link] [comments]

I have written my emacs config using org mode and source blocks, mainly for the convenience of having averything organized in clear-cut sections. I have in my init.el only instructions to load the configuration with org-babbel and to load an external custom file. I was wondering whether are there any cons to this approach, mainly startup time and performace wise... are there any? Should I go back to a more traditional init.el? submitted by /u/Bortolo_II [link] [comments]

Hello! I am trying to find extension to emacs that can create structure from special comments marks, the example is https://packagecontrol.io/packages/Comment%20Marks Thank you in advance! submitted by /u/georgtree [link] [comments]

Hello everyone :) This post is somewhat long: a first section describing the current setup I'm trying (and why), and a second section with the precise treesit.el issue I'm running into. Appreciate your help! What I'm trying to do I want to add syntax-highlighting to code-blocks in Markdown. As far as I know this isn't currently supported by any package. I also want to gain a better understanding of how to use tree-sitter in major modes: I found this page explaining how to use it to parse multiple languages in the same buffer, so it seemed like the perfect candidate. Where I got so far using treesit-auto, I was able to install a parser for markdown pretty quickly. I'm using this one I defined a minimal mode markdown-ts-mode which inherits from markdown and simply takes care of setti…

I'm debating between a Tex Shinobi and a ZSA Moon Lander, which would be best? submitted by /u/Firm_Evening_8731 [link] [comments]

The second pretest for what will be the 30.1 release of Emacs (the extensible text editor) is now available. submitted by /u/allgohonda [link] [comments]

I changed default fonts on my system (gui emacs-plus@31)and noticed that the bottom visible line in a maximized window & frame was partially covered by the mode line. I have done searching but I haven't learned much. Is there some standard way to make sure an integral number of lines are displayed? I ended up tweaking my font size up until it looked better, but eshell is still hiding the bottom half of the last line. My greatest challenge with issues like these are my lack of familiarity with Emacs terminology and context. It's taken me too long to get the distinction between face and font, as one example, so feel free to correct my terminology and expand my vocabulary. Thanks. submitted by /u/eileendatway [link] [comments]

hello people! dabbled into the world of UNIX text editors recently. (only now even though its been months since i've been on Linux, but better late than never haha) seeing what Emacs is theoretically capable of doing, i was interested in using it, and especially over vim given its extensibility. some potentially useful context is that i'm a student and am looking for a tool that would make computer use easier and/or faster as you get the hang of it. i also might seriously start learning programming soon, so i thought picking up a UNIX text editor before then would be a good idea, so i'd be more efficient doing this. i did put learning programming on hold though because training on freeCodeCamp just makes my left pinky hurt with the Shift key :(. i'm a huge beginner to text editors in gen…

Title. I'd like to be able to press hotkey / call function when I am next to word I want to check and it checks only this word (no constant "ON", no checking full buffer, etc - only single word and only when I call) submitted by /u/MorePeppers9 [link] [comments]

Emacs 29 introduced the --init-directory system, but I'm more interested in one where the init.el, and set of packages and their versions is the same. I think it should be possible to use the same init.el so long as conditional inclusion based on the Emacs version is done properly. Is it possible to set the package locations to the same directory even if the --init-directory is different? I remember from years back that the .eln cache directories are separate for each Emacs version. In short, if the default output directories any Emacs build expects to be available are made read only can they be overriden by some command line settings or environment variables or some other configuration files? Some of my data files have wound up in my init.el directory but I need a way to upgrade Emacs to a newer version without any conflicts trashing that data until I can get them separated, and that is why I'm asking this question. submitted by /u/vfclists [link] [comments]

some background before i start yapping i'm college student and i used vim for around 2 years so i dont' have a lot of experience about text editors and IDEs but vim was beautiful and when i switched to neovim it was awesome i thought nothing better could be there because nvim had everything i ever wanted i mean what else do i need except a programmable editor but i saw emacs folks being treated like gods by the linux community and i thought of giving it a try once fucked up ... i couldn't understand a single word elisp magit dired what does that even mean, after trying for a week i was traumatised i switched back to nvim where i felt comfortable and felt that emacs was just a sham few months pass by and i make wierd posts on emacs triggering the emacs community (this specific reddi…

This indentation command has no effect in 31.0.50 but works in 29.4, what am I doing wrong? (setq c-default-style "bsd" c-basic-offset 4) submitted by /u/xorbe [link] [comments]

Swimming with Ideas This is yet another opportunity to share what you are working on with your friends here on the forum. Add to this discussion by telling us about your zettelkasten journey. Share with us what you’re learning. Sharing helps us clarify our goals and visualize our thinking. And sometimes, a conversation sparks a magical moment where we can dive into an idea worth exploring. I’d love to hear more from you. 🫵🏼 Do you want to do a live video chat with me with questions or to share about our adventures in Zettelkasting? Ping me at @Will, and we can schedule a time. Here is my report on why I’m here and my current ZK work themes and ideas: My work themes for the last two weeks have been writing and coding. I’m in a magazine feature writing class to which I’ve devoted a lot of time. My reading has centered on writing skills and the fascinating memoir of the D.C. Federal District Court Justice David Tatel. This is a surprising intersection with my current writing assignment, which is a feature article on disability and diversity. Books I’m reading or read this week: Adler, Mortimer Jerome and Van Doren, Charles Lincoln. How to read a book. 2014.[[202407311603]] Blundell, William E. The Art and Craft of Feature Writing: Based on the Wall Street Journal Guide. New American Library, 1988. [[202408212021]] #JAMM425 Bookshare Tatel, David S. Vision: A Memoir of Blindness and Justice. First edition, Little, Brown and Company, 2024. Zettelkasting Soundtrack: LUX Secret Life Hollie Kenniff ★★★★★ The "My rolling fourteen-day zettel production" is produced by a script for attachment to my daily journaling template. I do my journaling in Bear to keep personal journaling separate from my knowledge work. Let me know if you would like to see, discuss, or critique any of these notes. My fourteen-day zettel production I hope my contribution is helpful, and I’m sure you have even better ideas.  ( 4 min )

Adrien Piquerez at the Scala Center writes on Mastodon: Yesterday I deployed the new Scaladex API, which you can use to get the list of all Scala projects and artifacts, filtered by Scala version, or platform: JVM, Scala.js, Scala Native, or sbt and Mill for plugins. Check it out here: https://index.scala-lang.org/api/doc/ submitted by /u/Seth_Lightbend [link] [comments]

Hi, I use the eat package and want to customize its eat-semi-char-non-bound-keys variable. However, I found setq or add-to-list has no effect to the eat package. Even though I can see the changes have been made, but the eat program does not respond to the changes. If I use the custom-set-variables to change the value of eat-semi-char-non-bound-keys, the eat program's behaviour changed as expected. I never heard of any special effect of the custom-set-variables function. I always think it is same as use setq. What am I missing here? submitted by /u/davidshen84 [link] [comments]

This character is appended by Firefox when it sleeps some tabs - 💤 but in one of my files it is not displaying properly. It is displayed as \360\237\222\244, but when I copy that into this Reddit post it displays fine, and when I copy the properly displayed character from this reddit text input back into the scratch buffer it displays correcly there as well. I noticed the first character on the modeline changed to = instead of the usual U with tool tip saying that the file was of an unknown coding or Emacs had made it so. After changing it to U with the 3rd mouse click it still shows in the numeric code above. I think something may have changed in the file to cause this. Is there some edit I have to make to the file to fix this problem? submitted by /u/vfclists [link] [comments]

Anyone out there adapted a consult-ripgrep implementation to support project-or-external-find-regexp? submitted by /u/shipmints [link] [comments]

submitted by /u/organess0n [link] [comments]

Hi all, I typically like to use my emacs for code in a vert split two panes fullscreen setup. As distractionless as possible. With projectile I can find my project file quite handily, however... However. Sometimes, more often than I like to admit, I need to browse the source tree, just to get a sense of the org. For tree browsing I use treemacs and I use neotree and both are failing me in the window width department and the fact that their window / pane / frame / rect that draws is a special one. Do you recognise this issue? Do you have tips? I was reminded of this itch I want to scratch bc I recently read a post of a vimmer that jumped ship and he wrote a post abt the corresponding pkgs between vim and emacs and what stuck out to me is that he placed dired across nerdtree. Not treemacs, dired. And he also added "nerdtree - dired (trust me)" and I felt that. I quickly realised that dired would not work for me as it does not should the dir structure, but the urge to scratch the itch is reignited. My main issue with Treemacs and nerdtree is that the window is fixed and with deeper trees and longer filenames that is quickly an issue. I cludged it by setting a wide width and relying on quick toggle shortcuts, but sometimes a toggle messed with the proportions of the other windows when I toggle out and when the tree is too deep and the names are too long, linebreaks mess everything up. I never got to a point where I can have the window follow the current dir and scrolls sideway to fit said dir as much as possible. Again, some insights, tips or similar rants are greatly appreciated. thx, S submitted by /u/Sndr666 [link] [comments]

https://preview.redd.it/qyn0q3m3gtwd1.png?width=3456&format=png&auto=webp&s=67ad212d266400995e7f4046a503513ba46993cb I have enabled visual-line-mode and this works great. However, now, when I do C-k it's actually only cutting to the end of the line, not the end of the word-wrapped line. Does anyone know how to solve this issue? Also, if someone could help me figure out why the background of my org src block is not the same when the word wraps, that would be great. I have the following set-face-attribute : (set-face-attribute 'org-block nil :background "#1f2335") submitted by /u/clementjean [link] [comments]

Hi all, Just wanted to share some code I've used these last few years to modify PDF metadata. I desired such functionality because I often read and annotate PDF files (especially when I was a student), and with pdf-tools's powerful commands to navigate PDFs via pdf pagination (pdf-view-goto-page), actual pagination (pdf-view-goto-label), and outline (pdf-outline, or consult's consult-imenu), a PDF's metadata can become very handy --- when accurate. Some PDFs have crappy or missing metadata (e.g. no outline, no labels/actual pagination). I hadn't found any existing package to do this (and still haven't), so I wrote a few lines of code to leverage Linux's pdftk binary. It creates a new buffer whose contents represent the PDF metadata; users can change the buffer contents to their liking then write those changes to the actual file. Here it is: https://gist.github.com/krisbalintona/f4554bb8e53c27c246ae5e3c4ff9b342 The gist contains some commentary on how to use the commands therein. I don't know the availability of pdftk on other OSs, nor what the comparable CLI alternatives are, so right now I can only say this is a solution only for Linux. If there is enough interest in the code snippet, I'll consider turning it into a MELPA package with options, font-locking, more metadata editing commands, etc. Cheers! submitted by /u/krisbalintona [link] [comments]

submitted by /u/Veqq [link] [comments]

Hello everyone. I am needing to figure out how to create a function that would add a url in front of some numbers. Here is an example: I have a list of numbers: 10258913018 10264412947 10220112906 10299213037 10259113024 10240313090 10212912838 10221313069 10212213125 10221412941 10219512936 I am wanting a way to select those numbers and run a function that would put a url in front of them like this: http://example.com/10258913018 Can somebody help me with this? I am sure it is easy but I do not know lisp. Thanks! submitted by /u/thisadamis [link] [comments]

I have just installed u/karthink /Tecosaur's org-mode branch, because I wanted to try out the new LaTeX-previews... And they work great! However, with this version of org-mode, LaTeX export no longer works, and it gives me some errors I have never seen before, looking like they have to do with some sort of caching and precompiling that goes wrong. Is this a known issue, and any idea how to solve it? I would love to be able to use this org as my daily driver. submitted by /u/thriveth [link] [comments]

I’m experimenting with using aliased files in The Archive, and am having trouble. I created an alias copy of a note. It would not appear in the note list. Changing its name by removing the alias extension made it show up in the note list. When I open it in The Archive, this is what I get. The name in the note list is accurate. The Word Count is inaccurate. In The Archive, it reports 821, and in IA Writer, it opens fine, but it reports 508. I see unusual gibberish and several blank lines in The Archive but the same file look fine in IA Writer. Does anyone have any tips? I’m trying to put selected notes on the web. I’m using Jeykl for this and coding with VS Code. I’m posting the results at JAMM425 Magazine Feature Writing. Warning: this is a work in progress.  ( 5 min )

The dir-treeview package has been updated to version 20241025.2251.

The treeview package has been updated to version 20241025.2249.

The evil-mc package has been updated to version 20241025.2045.

The ytdl package has been updated to version 20241025.1913.

The ct package has been updated to version 20241025.1844.

The spacemacs-theme package has been updated to version 20241025.1536.

The macrostep package has been updated to version 20241025.1456.

The i3bar package has been updated to version 20241025.1417.

The biblio-gbooks package has been updated to version 20241025.1400.

The mistty package has been updated to version 20241025.1214.

The ekg package has been updated to version 20241025.456.

(Disclaimer seems necessary for the current environment: I am doing it purely for the joy of doing some Haskell code.) https://github.com/hellwolf/haskell-examples/blob/master/2024-10-26-usa-election/election.hs It includes: nubmer of combinations of all possible outcomes number of combinations of tied outcomes winning combinations and probability for either red or blue total chance for red or blue to win Example outputs: Total combos: 128 Tie combos: 3 ***** Red Winnings ***** 4.561% 312 nv az wi mi pa nc ga 6.335% 301 nv wi mi pa nc ga 6.335% 296 nv az wi mi pa nc 6.424% 296 nv az wi mi pa ga 6.911% 306 az wi mi pa nc ga 7.477% 293 nv az wi mi nc ga 8.002% 302 nv az mi pa nc ga 8.446% 297 nv az wi pa nc ga 8.798% 285 nv wi mi pa nc 8.922% 280 nv az wi mi pa 8.922% 285 nv wi …

Hi there! I'm currently a master's student and for my master's thesis I have been tasked with writing a type checker and evaluator for a lambda calculus similar to the simply typed lambda calculus. The project sounds really interesting but I'm a little bit hesitant since I don't have much experience writing this kind of stuff. Does anyone have experience writing type checkers in Haskell and could provide some advice? Are there any useful resources to make my job easier? How many months would you estimate for such a project if working on it daily? Thanks in advance! submitted by /u/Fantastic-Trash-8236 [link] [comments]

submitted by /u/peterb12 [link] [comments]

submitted by /u/baldingbryan [link] [comments]

The code of copilot-core contains a couple of existential types. One example is: data UType = forall a . Typeable a => UType { uTypeType :: Type a } I'm writing the tests and HPC reports that uTypeType is a top-level definition that is never used, so coverage is not 100% for that module. The function is still considered unused for the purposes of coverage if I use uTypeType as a record field selector in a test. Is there a way to write a test that uses uTypeType as a function? submitted by /u/ivanpd [link] [comments]

Just learning Haskell but I am experienced in other languages. Which ide provides the best language server support? I am fluent in vi, emacs, visual studio C++ and Xcode . I’m on macOS ( if that matters ) . submitted by /u/964racer [link] [comments]

Hi! I need to add to a Haskell tool the ability to communicate with gitlab, github and jira/bitbucket. Do any of you use the following libraries in production? https://hackage.haskell.org/package/gitlab-haskell https://hackage.haskell.org/package/github Would you recommend any alternatives to those? Do you know one for jira? I need to interact with issues, merge requests, comments, etc. Thanks, Ivan submitted by /u/ivanpd [link] [comments]

submitted by /u/tomejaguar [link] [comments]

I need to create an system that tracks entities in 3d that moves around in a 3d structure. Entities send observations to a server and the server responds with a decision where the entity should go to. My problem is that this type of thing is high risk and so should be correct. So i instantly thought of haskell. However i am not sure if I can do this with a 2 man team. This is basically 3d path planning with constraints. It should be able to read 3d objects formats and so on. Another factor is speed. Several entities will connect to this and the system should not instruct to entities to move to a space such that at least 2 entities will occupy the same space(a cube or sphere or radius R) at the same time. Is Haskell the right language for creating, basically a hive mind? Note: entities are robotic ants in a synthetic 3d structure and communicate via a small embedded chip. The ants might use c++ just for query and receive. The computations will happen on the hivemind server submitted by /u/MysticalDragoneer [link] [comments]

Hello all. I use Doom Emacs, and am mostly setup. One thing preventing me from moving away completely from Webstorm is my inability to debug server + client code simultaneously using lsp-mode + dap-mode. This is my debug template: ;; Full stack debugging (dap-register-debug-template "NextJS" (list :type "node" :request "launch" :program "${workspaceFolder}/node_modules/next/dist/bin/next" :args ["dev"] :cwd "${workspaceFolder}" :skipFiles ["/**"] :outFiles [ "${workspaceFolder}/.next/**/*.js" "${workspaceFolder}/dist/**/*.js" ] :serverReadyAction (list :action "debugWithChrome" :killOnServerStop t :pattern "- Local:.+(https?://.+)" :uriFormat "%s" :webRoot "${workspaceFolder}") :name "NextJS")) When I run debugging, everything seems to work fine...except when I press continue I get this error: https://preview.redd.it/mtreyvkjiswd1.png?width=1907&format=png&auto=webp&s=b583ec6192cfe2d31ed044f7123e2a6e00680caf I'm not really sure how to fix this. I've tried pressing ss to open session view, and then stopping the thread...but then it just creates a new one. And if I stop that one, it makes another one, and so on. I've tried looking it up online, but all I can find is stuff that is either about debugging server code, or client code, but not the full stack at the same time... If anyone could give me some guidance, I'd appreciate it greatly. Thank you! submitted by /u/Broad-Lack-871 [link] [comments]

xref.el is a great way to navigate, but unfortunately it is only relevant for programming language navigation. I don't find a way for xref.el to manually/automatically mark the current point to provide forward and backward navigation. Now: empx.el is here. empx.el can be based on: Idle time Trigger function xref.el triggering method Mark the current point to provide more forward and backward navigation records. repo: https://github.com/ISouthRain/empx submitted by /u/Limp-Vermicelli-5815 [link] [comments]

I'm trying to access a local Llama 3.2 model living in GPT4ALL, using the carthink/gptel package. I have configured gptel according to the docs on GitHub, but I fail to get it working. The model is responding, and the log looks ok, but the model response is just garbage. This is my configuration for gptel; (use-package gptel :ensure t :bind (:map global-map ("s-i g" . gptel) :map gptel-mode-map ("C-c C-c" . gptel-send)) :config (setq gptel-log-level 'debug) (add-to-list 'gptel-directives `(prog-c++ . "You are a large language model and a careful programmer in C++ that lives inside Emacs. Provide code and concise explanations. Keep the explanations brief.")) (add-to-list 'gptel-directives `(prog-python . "You are a large language model and a careful programmer in Python that lives inside Emacs. Provide code and concise explanations. Keep the explanations brief.")) (setq gptel-max-tokens 5000) (setq gptel-model 'Llama-3.2-3B-instruct-Q4_0.gguf) (setq gptel-backend (gptel-make-gpt4all "gpt4all" :protocol "http" :host "localhost:4891" :models '(Llama-3.2-3B-instruct-Q4_0.gguf)))) Anyone else got this working? submitted by /u/mickesp [link] [comments]

rustic git page suggests:- (remove-hook 'rustic-mode-hook 'flycheck-mode) It doesn't work, though : I still get flycheck mode. I've fiddled about and got nowhere fast. (defun my/rust-mode-hook () (message "my/rust-mode-hook") (remove-hook 'rustic-mode-hook 'flycheck-mode) (remove-hook 'rustic-mode-hook 'flymake-mode-off) (setq indent-tabs-mode nil) (flycheck-mode -1) (prettify-symbols-mode) ;; (lsp-deferred) (if (featurep 'yasnippet) (yas-minor-mode))) If you've managed to turn off flycheck in rust/rustic I'd love to hear from you! ;) submitted by /u/rileyrgham [link] [comments]

my typescript-language-server uses the globally installed TS version. I'm trying to make it use the project local one via :initializationOptions and no luck. So far the :initializationOptions / :preferences has worked properly for me, not sure why the :tsserver section appears to be ignored. I may be using wrong file path blob. this is my TS config for eglot: (add-to-list 'eglot-server-programs '((typescript-mode) "yarn typescript-language-server" "--stdio" :initializationOptions ( :tsserver ( :path "./node_modules/typescript/lib/tsserver.js" :logDirectory "./tsserver.log" ) :preferences (;;https://github.com/typescript-language-server/typescript-language-server#initializationoptions :includeCompletionsForModuleExports nil :includeCompletionsForImportStatements t ;; experimenting ... but seems to have no effect :includeInlayParameterNameHints: "all" :includeInlayParameterNameHintsWhenArgumentMatchesName t :includeInlayFunctionParameterTypeHints t :includeInlayVariableTypeHints t :includeInlayVariableTypeHintsWhenTypeMatchesName t :includeInlayPropertyDeclarationTypeHints t :includeInlayFunctionLikeReturnTypeHints t :includeInlayEnumMemberValueHints t ;; not sure this is the right section :noErrorTruncation t :codeActionsOnSave ( :source.organizeImports t :source.removeUnusedImports.ts t) )))) submitted by /u/gdanov [link] [comments]

Any suggestions on a package that I can use to quickly access directories with keybinding? The key can take me to the dired buffer. I liked dirvish-quick-access but I wanted something lighter or something within emacs itself. I tried emacs registers but, I wanted something that I can assign nested keys. For example (key value) ("bf" . "~/Documents/Books/Fiction/" "bp" . "~/Documents/Books/Philosophy/" "m" . "~/Documents/Movies") submitted by /u/n0t3z [link] [comments]

I running Ubuntu 24.04 with Emacs 29.3 under WSL2. I managed to resolve almost everything I need on that install. Neovim is actually integrating fine with the setting set clipboard+=unnamedplus but I have no idea what would be equivalent on Emacs. emacs -Q don't integrate either so I'm guessing that's a setting that is not specific to Doom Emacs. submitted by /u/macacolouco [link] [comments]

I'm using doom-modeline and would like to remove that Mail-symbol. I tried (setq doom-modeline-mu4e nil) (setq doom-modeline-gnus nil) but to no vail. Any idea which doom-modeline-variable is repsonsible for this display? https://preview.redd.it/i5zhej90xlwd1.png?width=506&format=png&auto=webp&s=a1cd28f8530d77d533ee376ed53d9a00324ac7a3 This is my config: (use-package doom-modeline :ensure t :init (doom-modeline-mode 1) :config (setq doom-modeline-lsp t) (setq doom-modeline-minor-modes nil) (setq doom-modeline-buffer-encoding nil) (setq doom-modeline-workspace-name t) (setq doom-modeline-project-detection 'project) (setq doom-modeline-buffer-file-name-style 'filename) (setq doom-modeline-time t) (setq doom-modeline-unicode-fallback t) (setq doom-modeline-enable-word-count t) (setq doom-modeline-icon t) (setq doom-modeline-major-mode-icon t) (setq doom-modeline-major-mode-color-icon t) (setq doom-modeline-gnus-timer nil) (setq doom-modeline-time-live-icon t) (setq doom-modeline-mail-icon nil) ;; Disable the mail segment (setq doom-modeline-env-enable-mail nil) ;; Disable mail notifications (setq doom-modeline-mu4e nil) (setq doom-modeline-gnus nil) ;; Ensure the clock is shown in the modeline (setq org-clock-modeline-total 'current) ;; Display only the current clocked time ;; Display the clock in the modeline (setq doom-modeline-time-icon t) ;; Optional: toggle time icon visibility (display-time-mode 1) ) My emacs is GNU Emacs 29.2 (build 1, x86_64-apple-darwin23.4.0, NS appkit-2487.50 Version 14.4 (Build 23E214)) of 2024-03-24 submitted by /u/tengisCC [link] [comments]

submitted by /u/casouri [link] [comments]

I need to introduce some endpoints on a legacy system and I'm having some problem with the actor system. I also have some ideas about the actor system: I don't see value. I think it's extra complexity for very little gains, I'm running on a single server, I don't need to invoke actors from other servers, so what's the point of actors? It makes the code more complex. I'm thinking on just using the HTTP server and then just calling regular Scala code. Is this a bad thing? submitted by /u/fenugurod [link] [comments]

- Bloop 2 - detecting custom mains Try it out in your favourite editor! https://scalameta.org/metals/blog/2024/10/24/palladium submitted by /u/tgodzik [link] [comments]

Read more about the reasons and what next steps are planned. https://scala-lang.org/news/post-mortem-3.6.0.html submitted by /u/tgodzik [link] [comments]

submitted by /u/lihaoyi [link] [comments]

The lsp-haskell package has been updated to version 20241024.1701.

The php-runtime package has been updated to version 20241024.1622.

The org-node package has been updated to version 20241024.1501.

The erlang package has been updated to version 20241024.1336.

The editorconfig package has been updated to version 20241024.1258.

The php-mode package has been updated to version 20241024.1241.

The company-dcd package has been updated to version 20241024.1152.

The language-id package has been updated to version 20241024.854.

The gams-mode package has been updated to version 20241024.448.

The olivetti package has been updated to version 20241024.219.

The slime package has been updated to version 20241024.144.

Welcome to another issue of Haskell Weekly! Haskell is a safe, purely functional programming language with a fast, concurrent runtime. This is a weekly summary of what’s going on in its community. Featured GHC 9.8.3 is now available by Ben Gamari The GHC developers are happy to announce the availability of GHC 9.8.3. Binary distributions, source distributions, and documentation are available on the release page. Harder-Coded: Simple Newtypes are for Scrubs by Curtis Chin Jen Sem There’s quite a few fun and nifty things you can do in Haskell to avoid developer error. One notable one is the usage of newtype, which some other languages have adopted. It avoids parameter blindness and ensures values are only used in specific locations. The trick I’d like to show right now, is to use DataKinds (…  ( 2 min )

The color-identifiers-mode package has been updated to version 20241023.2217.

The validate-html package has been updated to version 20241023.2029.

The git-cliff package has been updated to version 20241023.1559.

The magit package has been updated to version 20241023.1526.

The binder package has been updated to version 20241023.1154.

The consult-ls-git package has been updated to version 20241023.1113.

The posframe package has been updated to version 20241023.319.

The prism package has been updated to version 20241023.312.

The ivy-posframe package has been updated to version 20241023.258.

Hello there! I keep a backup of my google calendars in sync in a folder using https://vdirsyncer.pimutils.org/en/stable/, that in it self uses the vdir standard (https://vdirsyncer.pimutils.org/en/stable/vdir.html), meaning a folder with a bunch of .ics items. I'd like to know if there is anything I can do to integrate it with org-agenda. Meaning I'd like all the items to appear in org-agenda and org-agenda being able of modifing/creating/delete any .ics. Would I have to keep running imports/exports from/to a calendar.org? How would you approach this? Thanks! submitted by /u/LionyxML [link] [comments]

Anyone use orgmode or something similar on Neovim and with mobile app? Currently I only use Emacs for orgmode and for mobile app I'm using Orgzly-Revived. In Neovim, last I checked Neorg plugin is the most promising org-mode-like (it doesn't fully support .org file which is fine for me)--it has a mobile app as part of its roadmap but there's been no progress for 2+ years. What I like most about org-mode its org-agenda features (and plugins like org-super-agenda and org-ql that make it easy to view TODOs with preset filters). Something like VimWiki or markdown-like TODO lists aren't suitable because they are too close to "text-based", e.g. it's not nearly as powerful when it comes to searching notes where it naively simply searches by words (I use org-goto to search TODO headlines which usually yields desired results quicker). Hotkeys to set deadlines, TODO state, tags, and priorities are very convenient. A mobile app makes it super easy to quickly add a TODO note when random thoughts come up. The widget on the Orgzly-Revived mobile app e.g. shows my updated (via Syncthing) shopping list on a homepage of Android so I don't even have to open the app (I can also select a pre-configured sets of filters to view their results from the widget, e.g. upcoming deadlines, etc.). submitted by /u/exquisitesunshine [link] [comments]

Hi all, If I want to reduce the margins of a presentation (I usually have plots, I need the maximum screen real estate), I have to do it in the final version directly in the .tex file, which is annoying. I have to add the simple command : \setbeamersize{text margin left=5mm,text margin right=5mm}, but it has to appear after the beamer theme. But org export settings seem to put the theme at the end of the preamble, or at least after #+latex_header or #+latex_header_extra. Any ideas ? submitted by /u/aitam-r [link] [comments]

/**With the following method structure*/ var a = Some(123) def func1() = a match case Some(a) => 123 case other => "123" def func2(i: Int) = print(i) def func2(s: String) = print(s) /**is there a way to write the following in shorter form*/ func1() match case a: Int => func2(a) case b: String => func2(b) /**Like this*/ //func2(func1()) submitted by /u/c_lassi_k [link] [comments]

submitted by /u/sideEffffECt [link] [comments]

Hi, I'm the maintainer of Peloton, an actor library for Cats Effect that has recently been accepted as a Typelevel affiliate project. While being heavily inspired by Akka, the main goal for Peloton was not to be as close to Akka as possible, but to adopt modern Scala 3 and make use of Cats Effect. To this date, most of the features incorporated into the project originated from personal requirements, but now, especially as an affiliate project, I need some feedback and feature ideas from the community. I created a discussion over at the GitHub project for this. Please join and discuss if you're interested in Peloton. Of course, new contributors are also always welcome. Thanks! submitted by /u/Ath30n [link] [comments]

submitted by /u/mostly_codes [link] [comments]

given a type of data, how to know which functions accept it as an argument ? I am used to the dot (.) notation in other languages when I want to discover what operations are related to a type. I find myself asking copilot alot in Haskell, to the point where he is piloting and I'm just taking notes, what do you guys do ? is reading docs the only way to figure out what functions accept what types ? submitted by /u/I2cScion [link] [comments]

Hi everyone! Hope this message finds you well. I found this sub recently, and am curious about any uses this programming language might have for someone like me and the potential fields I'm interested in (consumer electronics, aerospace, automotive, etc.). I'm already well versed in Python and Matlab, and their purpose as a Mechanical Engineer, but is Haskell worthwhile to learn as well, or is it more suitable for more software oriented roles? submitted by /u/Dylan_Batyk [link] [comments]

I'm missing something huge in my Emacs workflow. Find/Replace across an entire project. Or the current directory and sub-directories. I was editing some html doc files and found myself reaching for VS Code to find/replace stuff across many files. I'd like to move this task into my Emacs workflow. Or maybe a command line powered technique (ripgrep?) I can wrap in an Emacs function. How do you find/replace? submitted by /u/Starlight100 [link] [comments]

As an experiment I'm trying to generate several defuns with one macro. I've come this far: `` ;; This works. If I run(msg 7)I'll get amsg-7 ;; defun that if called prints "7". (defmacro msg (n) "Make amsg-' function that prints N." (let ((cmd (intern (format "msg-%s" n)))) (defun ,cmd () ,(format "Message%s'." n) (interactive) (message "%S" ',n)))) ;; Creating many of these at a time like this though ;; just doesn't seem to do anything. (defmacro msg-many (m) "Make many (0 .. M - 1) msg-' functions." (dotimes (n m) (msg n))) ``` I'm pretty sure I'm missing something fundamental here. But how would I go about "calling" (or perhaps "expanding"?) a macro several times with different in-data? submitted by /u/mattias_jcb [link] [comments]

This is a thread for smaller, miscellaneous items that might not warrant a full post on their own. See this search for previous "Weekly Tips, Tricks, &c." Threads. Don't feel constrained in regards to what you post, just keep your post vaguely, generally on the topic of emacs. submitted by /u/AutoModerator [link] [comments]

How to setup emacs so that it can seamlessly read and annotate epub files and pdf files? Does anyone use this kind of setup how did you achieve this? please tell the package(s) name(s) and any additional step you did submitted by /u/Apkash [link] [comments]

I could have sworn I had this working in the past, but I forgot how. I am currently writing a package to simulate ACME. So far I have gotten mouse button functionality and mouse chording, but the buffer I'm using to display tag commands is 4 lines height. I would like to make it exactly one line. submitted by /u/Desperate-Purpose178 [link] [comments]

The mark-thing-at package has been updated to version 20241022.2232.

The git-link package has been updated to version 20241022.2208.

The yeetube package has been updated to version 20241022.2200.

The elpher package has been updated to version 20241022.1625.

The parinfer-rust-mode package has been updated to version 20241022.1625.

The hotfuzz package has been updated to version 20241022.1616.

The corfu package has been updated to version 20241022.1040.

The hyperdrive-org-transclusion package has been updated to version 20241022.833.

The casual-suite package has been updated to version 20241022.3.

A new v0.3.0 release of hyperdrive-org-transclusion is now available on NonGNU ELPA. The main change is that this org-transclusion extension can now be activated/deactivated with the new global hyperdrive-org-transclusion-mode. Setup instructions have changed. In your init.el, please replace (with-eval-after-load 'org-transclusion (add-to-list 'org-transclusion-extensions 'hyperdrive-org-transclusion) (require 'hyperdrive-org-transclusion)) with (with-eval-after-load 'org-transclusion (hyperdrive-org-transclusion-mode +1)) Please see the hyperdrive info manual for installation and setup instructions. hyperdrive-org-transclusion augments the org-transclusion package by Noboru Ota by allowing you to transclude hyperdrive content over a network. You can also transclude specific Org document headings by linking to them. This package is similar in nature to org-transclusion-http, which also lets you transclude content over the network (HTTP, not hyper). Feedback welcome! If you'd like to support USHIN's work financially, please donate here. Thank you! submitted by /u/breathe-out [link] [comments]

Hi! I recently switched to emacs for rust development. As you can see in the following picture, eldoc which is used by Eglot just writes down the documentation of a function/variable etc. in the window on the right side without any syntax highlighting or colors. https://preview.redd.it/hbye62r71dwd1.png?width=2786&format=png&auto=webp&s=9bcbf1cf00c10227863b6ec14482730da89f13e0 Is there any option, or plugin I am missing to get the output of eldoc with syntax highlighting? I found nothing In the documentation. This is the part of my LSP Config in my init.el (use-package eglot :ensure nil :defer t :bind (:map eglot-mode-map ("C-c a" . eglot-code-actions) ("C-c d" . eldoc) ("C-c f" . eglot-format-buffer) ("C-c r" . eglot-rename)) :hook (rust-mode . eglot-ensure)) (use-package rust-mode :ensure t :defer t :init (setq rust-mode-treesitter-derive t rust-format-on-save t)) Thanks for any informations! submitted by /u/zibebe [link] [comments]

I've decided to see how the copilot integration into emacs can work for me, and using the pre-built init.el located here https://robert.kra.hn/posts/2023-02-22-copilot-emacs-setup , I am able to get it to connect to my personal github account (at least the github website tells me I'm connected). However, I can't actually use the feature since it just gives me a "not authenticated / not authorized" error when I try to do any copilot operation (such as copilot-diagnose). I'm wondering if there's a way I can just use my MS account that my employer provides. I'm able to use copilot from the gizmo that is in my taskbar and on my browser, but I don't see anywhere to change the authorization mechanism in copilot.el. I've dug into the copilot.el files a little, but I'm not really an elisp hacker and I can't make hide nor hair of how they work - the authorization routine doesn't have any reference to github or any other urls, just variables that don't seem to be set anywhere. Ideas? submitted by /u/steve_b [link] [comments]

I decided to try using symbol shortands in a new package I'm sketching and I'm enjoying it a lot, so I'd like to share an idea. In the beginning I did the obvious thing: ;; Local Variables: ;; read-symbol-shorthands: (("mypkg-" . "my-package-")) ;; End: That I didn't really enjoy. It looks a bit unclean and isn't even that economic. But now I'm using this: ;; Local Variables: ;; read-symbol-shorthands: (("-" . "my-package--")) ;; End: which means that public symbols need to be spelled out in full, but private a.k.a. double dashed symbol just need a - as prefix. So for example: (defun -private-fun (n) (+ n 42)) (defun my-package-api-function (n) (when (numberp n) (-private-fun n))) I know some people had reservations with the notion of symbol shorthands, such as bad grepability. Maybe this approach alleviates some of the potential problems and could even be recommended as a general practice. WDYT? submitted by /u/astoff1 [link] [comments]

Hi r/emacs, I apologize if the title is a bit confusing. I use org-mode for all of my notes and logseq to view them on phone, but lately I've been maintaining an org journal based journal with encrypted files for every day. I was wondering if there were any apps that could let me read these encrypted org mode files as logseq does not have support for the same. I'm also open to using an alternate encrypted journaling system as long as (1) it is org-mode or markdown, (2) there is an android application for viewing notes and (3) I can sync files through syncthing. TIA! submitted by /u/cel7t [link] [comments]

Hi, emacs beginner here I'm currently try ti build my emacs config, but stuck with correct font naming in init.el I would like to use Victor Mono font, but don't know what is correct name for this font in this instruction: (set-face-attribute 'default nil :font "???????" :height 120) When i put "Fira Code", for example, it's working and set up Fira Code font. submitted by /u/Tempus_Nemini [link] [comments]

When navigating the HOME folder on dired using Emacs at MS Windows, it displays all the System files and Hidden files. That bothers me because it makes the HOME directory cluttered from within dired. Is there anyway to make those files also Hidden on dired like the file explorer or the dir command on windows cmd? submitted by /u/AriaCaracciolo [link] [comments]

Emacs is a very misunderstood tool. Many people are confident in saying that Emacs can't do anything modern, is very difficult to use, and that young people cannot learn it at all. As far as I understand, these statements are all false. When a director of software engineering at work said so, I responded, "No. What you're saying is totally wrong." Later that day, he dropped by my desk while I was writing a technical document in org-mode using gptel. As I quickly wrote sections and the first sentence, it immediately completed the rest of the section, including code examples. That blew his mind. He asked, "What is this? Did you copy and paste it from somewhere else?" I replied, "No, I'm writing a document in Emacs with the power of my choice of LLMs." When he asked if it was difficult to ev…

submitted by /u/kickingvegas1 [link] [comments]

UPDATE: OK, the problem appears to be due to the interaction of AUCTeX, with TeX-parse-self set to t, and reftex. When trying to run org-export-as-latex I get the error in question. This is the minimal configuration needed. (use-package latex :ensure auctex :mode ("\.tex\'" . LaTeX-mode) :init (setq TeX-parse-self t) (require 'reftex)) (Setting TeX-master also to t makes no difference.) I guess I could manually toggle the value of TeX-parse-self before any call to org-export-as-latex, but it seems like there should be a smarter solution... After starting an instance of vanilla emacs (emacs -Q), calling package-initialize, and then evaluating the following snippet I'm able to generate a LaTeX buffer from an org-mode file, as expected: (use-package latex :ensure auctex :mode ("\\.tex\…

submitted by /u/crtschin [link] [comments]

While doing exercises at exercism.org, I found a problem that includes the following line: import Data.Map (Map) What exactly does this line do and how is it different from import qualified Data.Map as Map (which I'd normally use)? I've looked at https://wiki.haskell.org/Import and I don't see this format mentioned there (unless "Map" in parentheses is the name of a function which it probably isn't because it's uppercase). Looking at https://hackage.haskell.org/package/containers-0.7/docs/src/Data.Map.html also didn't make me wiser. ANSWERED: The first "import" imports only the type "Map" (defined in Data.Map) and the import is not qualified so the type is subsequently available both as "Map" and as "Data.Map.Map". submitted by /u/fuxoft [link] [comments]

Hello All, experienced graphics developer here . I’m looking to learn a new language. I thought it was going to be lisp but I got tired of getting old libraries to work . Haskell is on my list . Does anyone have any 3D project suggestions? What is needed ? I’ve seen some work on parallel arrays with the gpu. I’m also fascinated by the live coding community. Is there anything out there like tidle cycles for graphics? I don’t see much work in graphics. Is Haskell a poor choice? submitted by /u/964racer [link] [comments]

submitted by /u/MaxGabriel [link] [comments]

Hi all, I have been delving into Haskell. The one thing that I would like to have is a way to goto definition of functions / types. I tried to get this working via lsp server in Emacs, but the haskell-language-server-wrapper seems to hang. I've also tried using the haskell extension in Visual Studio that seems to at least be able to call the Haskell LSP. However, VSCode, can't even show the definitions for functions / types in the same file! I've done some initial exploration and it seems like ghcide at some point could do this, but it's since been merged into the main haskell language server and no longer supports this feature. It is supposed to work for local files, but alas it's not working for me. This is how I "git gud" at new programming languages, through exploration of libraries that I am using. Go to definition is key for me. That way, I can learn how people who are experts write code. I currently have a project setup using stack that I've been exploring, if that matters. How do you do code exploration for even a small code base? submitted by /u/J_M_B [link] [comments]

With Haddock it's easy to see how I can construct a value of some Haskell type. I can see the fields available in each constructor and the type expected in each of these. Is there anything similar to generate documentation for yaml/json configuration files? Think of the documentation for cabal files, for example. It has descriptions in prose of where each field can be used and the hierarchical structure of fields is not immediately evident. My current use case is that I have a Haskell type for the content of the yaml config file, but the audience writing these files are not Haskellers. An ideal solution would take a language-agnostic specification (with sums and producs of fields) and generate Haddock-like documentation which makes it clear what's expected in the config file. Does anyone know of something like this? submitted by /u/lazamar [link] [comments]

I've run into a tricky issue while trying to migrate to Scala 3. The main problem stems from a bug in Scala 2 Quill macros that affects schemaMeta. When you try to annotate schemaMeta with a type, it doesn't return the correct type for batch actions. If you let IntelliJ infer the type, it ends up generating a massive, unreadable type with a ton of compile-time IDs, rather than a simple SchemaMeta[YourType]. This causes problems, especially for Quill batch operations. Here’s what happens when using the Scala 3 migration flag "-quickfix:cat=scala3-migration": implicit val daoSchemaMeta: YourPostgresContext.SchemaMeta[YourType]{ def entity: io.getquill.Quoted[io.getquill.EntityQuery[YourType]] { def quoted: io.getquill.ast.Entity def ast: io.getquill.ast.Entity def id1796633896(): Unit val liftings: Object }} = schemaMeta[YourType]("your_table") implicit val daoInsertMeta: YourPostgresContext.InsertMeta[YourType] { def expand: io.getquill.Quoted[(io.getquill.EntityQuery[YourType], YourType) => io.getquill.Insert[YourType]] { def quoted: io.getquill.ast.Function def ast: io.getquill.ast.Function def id694044529(): Unit val liftings: Object }} = schemaMeta[YourType](_.id) Instead of just getting the expected SchemaMeta[YourType], you get this crazy output with compile-time IDs, which doesn't work with Quill batch actions. There's a related bug report here: https://github.com/zio/zio-quill/issues/1308. The kicker? Scala 3 requires explicit type annotations for all implicits, and we can’t bypass this even in "migration mode." So, we’re stuck in a Catch-22: Quill macros don't play well with type inference in Scala 2, but Scala 3 forces us to annotate everything, leaving us blocked by Quill. This essentially pushes us to go all-in on Scala 3 and Protoquill, which means a major rewrite. Has anyone else hit this roadblock? Any advice? EDIT Resolved: Seems like slapping @nowarn on every implicit schema allows to supress this error submitted by /u/juwking [link] [comments]

Hi, there, My question is if I wants to learn more about Type 2 Diabetes Management, and I already know some knowledge. Then I start to write an outline with possible subtopics to explore and to check if I'm confident on these subtopics and concepts. Then it does not sound like Zettelkasten right? But I did think this approach make more sense to me in terms of studying a subject. But if you guys have other suggestions, please feel free to speak, I just get confused on when to use Zettelkasten and what is it really.  ( 3 min )

Hi! I'm really thrilled to share that I just bought my first Macbook - 70% of the reason was so that I could use the Archive. Wanted to know what are the onboarding steps, what kind of tips and tricks you have been using to maximize experience, and most importantly how I can import my notes from Obsidian to Archive. Would love to know anything else you can share to help me start my note taking journey on the Archive  ( 3 min )

The casual-symbol-overlay package has been updated to version 20241021.2358.

The casual-avy package has been updated to version 20241021.2353.

The casual-editkit package has been updated to version 20241021.2326.

The mindstream package has been updated to version 20241021.2131.

The difftastic package has been updated to version 20241021.2105.

The casual package has been updated to version 20241021.1937.

The cider package has been updated to version 20241021.1757.

The ushin-shapes package has been updated to version 20241021.1724.

The mastodon package has been updated to version 20241021.1717.

The svg-tag-mode package has been updated to version 20241021.1341.

The glsl-mode package has been updated to version 20241021.919.

The tp package has been updated to version 20241021.654.

The comint-intercept package has been updated to version 20241021.629.

The dslide package has been updated to version 20241021.439.

The tree-sitter-langs package has been updated to version 20241021.437.

The mlscroll package has been updated to version 20241021.255.

Has anyone come across Emacs packages or code that supports the various SELinux policy definition languages such as the .te (type enforcement) , .if (interface definition) and several others? I did find some old (2003) code here: https://marc.info/?l=selinux&m=106451121120495&w=2 . I wonder if something more recent and comprehensive exists. I'm finding myself having to deal with SELinux and manage policies so any info would help. submitted by /u/prouleau001 [link] [comments]

Snippet at post https://lmno.lol/alvaro/hide-another-detail submitted by /u/xenodium [link] [comments]

Hi, all. I’m using vertico/orderless/marginalia and have been very happy with it so far. One small thing, though, is the sorting of files using find-file or find-file-other-window. I’d like the sorting to be by reverse date (most recent on top), but it gives it to me in something that looks somewhat random. I love the history of vertico for other commands, but I can’t quite get this to work. Suggestions? submitted by /u/hahahahthunk [link] [comments]

No cheating: what is your current emacs-uptime as of this very moment? Not your longest ever, your up time right now. And, should you feel your Emacs developer cred threatened, you may comment on the longest time you've had Emacs opened without closing it. View Poll submitted by /u/varsderk [link] [comments]

I'm trying to compile Emacs 29.4 from source with my own build options, using makepkg and a PKGBUILD file on my Arch-based system. In my PKGBUILD file I decided to include a make -k check to test the build: check (){ cd "$pkgname-$pkgver" make -k check } Unfortunately, I keep getting an error from emacs-tests/bwrap/allows-stdout as mentioned in this post's title: SUMMARY OF TEST RESULTS ----------------------- Files examined: 471 Ran 7205 tests, 7036 results as expected, 2 unexpected, 167 skipped 2 files contained unexpected results: src/emacs-tests.log lisp/progmodes/flymake-tests.log make[2]: *** [Makefile:341: check-doit] Error 1 make[2]: Leaving directory '/home/nonreligious/src/emacs-29.4-build/src/emacs-my-build-29.4/test' make[1]: *** [Makefile:310: check] Error 2 make[1]: Leav…

Emacs goes against the unix principle; do one thing and do it well. Emacs does everything and does it well. Enjoy! P.S. I do realise most things it can do are seperate projects. submitted by /u/Moist-Ice-6197 [link] [comments]

When checking which buffers to save with C-x s, the diff output (d option) would be displayed in a different buffer but the prompt would go back to the Save options (y, n, !, etc). Now for whatever reason, the cursor goes to the diff buffer, I have to quit the diff and then I am back to the save prompt in the minibuffer. Anybody else experience this issue recently? submitted by /u/No-Belt-2789 [link] [comments]

A while ago I came up with a function which turns Emacs + eat terminal emulator into really well integrated ssh connection manager, each connection in its own buffer starting with ssh-, it's super handy and comfortable to work with. The one piece I'm missing is being able to quickly open the (remote) CWD in dired. I really don't want to use tramp + dired to traverse remote directories, it's terribly slow, but I'd appreciate a quick way, being in a directory at the remote host, to open dired right there. I do have a one-liner to build a path Emacs (tramp) can understand, and it even understands if it needs to use sudo: L=`logname`; U=`whoami`; H=`hostname -f`; if [[ ${U} == ${L} ]]; then echo \"/ssh:${L}@${H}:${PWD}\"; else echo \"/ssh:${L}@${H}|sudo::/${PWD}\"; fi I'm looking for a good way to execute it and save the output to an elisp variable, or any kind of hack to do something similar with one keybinding/command. The 'connection manager' can be found here: https://www.reddit.com/r/emacs/comments/1dab1b0/how_to_run_a_command_in_an_existing_eat_terminal/ submitted by /u/LittleRise1810 [link] [comments]

https://preview.redd.it/5wtboqgnn2wd1.png?width=3624&format=png&auto=webp&s=734fbb19b1ac86e4ec45d4d4bf1a0a8e6d5f25fa The name was bad, I hope you like punch-line a bit better. I decided to add a ton of new features here to make up for the bad name, they are: Evil status Evil MC / and multiple cursors Macro recording Git branch and status Battery status Weather Information Eglot (just a little icon) Time Flycheck status Package updates Hidden vterm (and hopefully which command it runs) Copilot For macOS and Apple Music (song and artist information) Source code is here: https://github.com/konrad1977/punch-line submitted by /u/konrad1977 [link] [comments]

submitted by /u/MaskRay [link] [comments]

For other programming languages, I have packages like slime, cider, clj-kondo, etc. - which majorly augment the elegance of the dev experience, compared to raw-dogging it with eglot, a language server, and a dream. C++ has complicated builds, multiple build profiles, disparate build tools, etc. It's a completely foreign dev experience from the languages I'm used to. (Haskell, Clojure, ELisp, CL, etc.), and there's a swath of different dev tools, compilers, static analyzers, debuggers. It's different. I've seen references to CEDET - I do not know if this is still the way folks are doing things. What hacks have you written yourself to enhance your workflow? Is there a stack of modern, fledgling packages representing the future that ecosystem is moving towards? How are you folks doing it, in this Year of Our Stallman 2024? I imagine there are hackers in this beautiful digital landscape that have built a set of modern complementary packages that have evolved with c/pp as they have modernized, as well as make, cmake, gdb, and etc. Thanks, and much love. submitted by /u/arylcyclohexylameme [link] [comments]

Hello, I am asking this question to better understand what I believe to be a lack of understanding between the GHC interpreter and source files. When I declare fun1 = (==) in the interpreter, it is accepted and its type is deduced and shows as Eq a => a -> a -> Bool. Here's an illustration; Prelude> fun20 = (==) Prelude> :t fun20 fun20 :: Eq a => a -> Bool BUT, when I declare fun2 = (==) with the type declaration commented out in a source file, -- SOURCE.hs -- fun10 :: (Eq a, Ord a) => a -> a -> Bool fun10 = (==) ,then attempt to link to the source file in the interpreter, there is an error which reads SOURCE.hs:2:9: error: • Ambiguous type variable ‘a0’ arising from a use of ‘==’ prevents the constraint ‘(Eq a0)’ from being solved. Relevant bindings include fun10 :: a0 -> a0 -> Bool (bound at stupid2.hs:2:1) Probable fix: use a type annotation to specify what ‘a0’ should be. These potential instances exist: instance Eq Ordering -- Defined in ‘GHC.Classes’ instance Eq Integer -- Defined in ‘integer-gmp-1.0.2.0:GHC.Integer.Type’ instance Eq () -- Defined in ‘GHC.Classes’ ...plus 21 others ...plus six instances involving out-of-scope types (use -fprint-potential-instances to see them all) • In the expression: (==) In an equation for ‘fun10’: fun10 = (==) | 2 | fun10 = (==) | ^^^^ Failed, no modules loaded. Why isn't GHCI deducing the type of the function when linking to the source file? submitted by /u/laughinglemur1 [link] [comments]

Hello, I am trying to create a list of tuples of type Int,Int. As well, I am trying to create a function which selects the second index of the third tuple. Here is FILE.hs; xs :: [(Int,Int), (Int,Int), (Int,Int)] xs = [(1,2), (3,4), (5,6)] select6thElem :: [(Int,Int), (Int,Int), (Int,Int)] -> Int select6thElem [(_,_), (_,_), (_,num)] = num Next, I attempt to link to FILE.hs in GHCI and receive the following error messages; Prelude> :l FILE.hs [1 of 1] Compiling Main ( stupid.hs, interpreted ) FILE.hs:2:7: error: Illegal type: ‘[(Int, Int), (Int, Int), (Int, Int)]’ Perhaps you intended to use DataKinds | 2 | xs :: [(Int,Int), (Int,Int), (Int,Int)] | ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ FILE.hs:5:18: error: Illegal type: ‘[(Int, Int), (Int, Int), (Int, Int)]’ Perhaps you intended to use DataKinds | 5 | select6thElem :: [(Int,Int), (Int,Int), (Int,Int)] -> Int | ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ Failed, no modules loaded. I have looked at various other examples online, and can't find a reason as to why my list of tuples of type Int,Int isn't valid. Can someone help me find where I've went wrong? Thanks in advance! submitted by /u/laughinglemur1 [link] [comments]

https://codoc.tech Reviews and feedback are welcomed. submitted by /u/Remarkable_Jump_6467 [link] [comments]

Hi, when I try to run 'cabal repl' on my project, the following error is returned Configuring library for OpenGLRaw-3.3.4.1.. Error: .cabal-wrapped: Missing dependency on a foreign library: * Missing (or bad) C library: GL This problem can usually be solved by installing the system package that provides this library (you may need the "-dev" version). If the library is already installed but in a non-standard location then you can use the flags --extra-include-dirs= and --extra-lib-dirs= to specify where it is.If the library file does exist, it may contain errors that are caught by the C compiler at the preprocessing stage. In this case you can re-run configure with the verbosity flag -v3 to see the error messages. Error: cabal: Failed to build OpenGLRaw-3.3.4.1 (which is required by lsystems-0.1.0.0). See the build log above for details. Here are the relevant packages I have installed environment.systemPackages = with pkgs; [ freeglut libGL libGLU ghc cabal-install libgcc]; This other post seems to have had a similar issue to me https://www.reddit.com/r/haskell/comments/rjfigu/noob_question_about_graphicsgloss/ . But I should have these packages on my $PATH as I declared them in my configuration.nix. Thanks for any help! submitted by /u/Splippity [link] [comments]

There are two raw bindings for OpenGL : OpenGLRaw and gl . How are they different and which one should I choose ? submitted by /u/AliceRixte [link] [comments]

As I read through the Clean Architecture book, I learn about interesting metrics. One is Instability, and another one is Abstractness. I like the idea, but can't properly see how to measure them in different FP languages. Instability might be okay, I count imports in the module, and I count how much times my module was imported. But what about abstractness, in the book it's a percentage of the abstract classes in a module divided by total number of classes. But let's say I write in Haskell, I don't have abstract classes, or any other classes. I do have type aliases, data and newtype definitions and typeclasses, how can I measure abstractness in a language where not everything is a class? submitted by /u/imihnevich [link] [comments]

Hi want to configure a cabal package so that, when HPC is executed during testing with coverage enabled, it ignores certain definitions, for example: Anything that is auto-generated (e.g., `Show`). Constructors and field accessors are assumed to all work. `Proxy` I think there's a way to extract the tix file and modify it, but I'm trying to make this automated, and configure cabal so that the right options are passed to HPC, and that way even hackage will pick it up when it reports the coverage of our library. Any pointers? (This is, specifically, for copilot-core). submitted by /u/ivanpd [link] [comments]

submitted by /u/bgamari [link] [comments]

submitted by /u/tomejaguar [link] [comments]

Working with the Exists ⊣ Const adjunction we can generate some wacky isomorphisms of forall a. a -> f a: forall a. a -> f a = forall g x. g x -> f (Exists g) = forall g. Fix g -> f (Exists g) = forall g a. (a -> g a) -> a -> f (Exists g) The adjunction Exists ⊣ Const implies the existence of (. Const) ⊣ (. Exists), where (.) = Compose: (. Const) hof ~> f = hof ~> (. Exists) f hof . Const ~> f = hof ~> f . Exists (forall x. hof (Const x) -> f x) = (forall g. hof g -> f (Exists g)) We now have an equation for any higher-order functor hof :: (k -> Type) -> Type. Trying it with Applied a :: (k -> Type) -> Type yields forall x. x -> f x forall g a. g a -> f (Exists g) (forall x. Applied a (Const x) -> f x) = (forall g. Applied a g -> f (Exists g)) (forall x. x -> f x) = (forall g a. g a -> f (Exists g)) Trying it with Fix :: (Type -> Type) -> Type. The fixed point of the constant function fix (const x) returns the argument of the constant function: x. This against leaves us with forall x. x -> f x. (forall x. x -> f x) = (forall g. Fix g -> f (Exists g)) The type-level fixed point Fix g is equivalent to the greatest fixed point data Nu g where Nu :: (a -> g a) -> a -> Nu g. We can unfold this: = (forall g a. (a -> g a) -> a -> f (Exists g)) Why not use Yoneda f (Exists g), does this give us something? Nope doesn't look like it. = (forall g a x. (a -> g a) -> a -> (Exists g -> x) -> f x) Ok ciao! submitted by /u/Iceland_jack [link] [comments]

Hi all, We are conducting a survey regarding your experience with medium and long-term maintenance of Scala projects to pinpoint the most common problems. This knowledge will help us to tune our priorities and better understand what problems projects face when they grow and mature. It will impact both our FOSS efforts and commercial offerings. I would like to ask you to fill this survey and share it with your colleagues. We will compile a report when the survey is finished with our thoughts, ideas, suggestions and plans for the problems discovered by the survey. You can provide an email and we'll send the report to you once it's available. Link to survey: https://form.typeform.com/to/s6KxS8F7 https://preview.redd.it/4l27xacoo3wd1.jpg?width=1200&format=pjpg&auto=webp&s=ce2eb401f37dbf19f0d33afdabc0203321d8f20d Łukasz, Scala Developer Advocate @ VirtusLab submitted by /u/lbialy [link] [comments]

submitted by /u/eed3si9n [link] [comments]

The gpr-ts-mode package has been updated to version 20241020.2248.

The earl package has been updated to version 20241020.1847.

The gpt package has been updated to version 20241020.1841.

The meow package has been updated to version 20241020.1605.

The modus-themes package has been updated to version 20241020.1338.

The lem package has been updated to version 20241020.1147.

The wordreference package has been updated to version 20241020.1145.

The clause package has been updated to version 20241020.1144.

The org-roam-ql package has been updated to version 20241020.516.

The vimscript-ts-mode package has been updated to version 20241020.7.

submitted by /u/petrzapletal [link] [comments]

https://contributors.scala-lang.org/t/broken-scala-3-6-0-release/6792 submitted by /u/DueKaleidoscope1884 [link] [comments]

I think I just became a Direct Scala evangelist. I'm starting to believe that with green threads introduced in JVM 21 there are less and less reasons to use effect systems in the majority of use cases. I've been learning Scala for 3 years now (at work I'm predominantly a Python developer as a data engineer - we use Scala only for Spark and even here there are opinions that it should be moved to pyspark) and I love it. The type system, the for comprehensions, the most advanced pattern matching I've seen anywhere and my favorite error handling system with Options and Eithers - all of these lead to great software where a lot of errors are prevented at compile time. I won't use the buzzword "secure" because you can still write bad code and bugs will still appear, but it's still much easier to…

submitted by /u/Krever [link] [comments]

submitted by /u/eed3si9n [link] [comments]

Instead of making a lot of playlists with many repeated songs, like "Rock", "Best Rocks", "Rocks from 80s", "Rocks for workout", I would like to be able to tag songs similar to org tags: Song 1 - :80s:rock:best:workout: Song 2 - :anime:rock:best:workout: Song 3 - :funk:game:mario:cover: Song 4 - :rock:workout: And be able to build playlists based on combination of tags, for example :best: should give me songs 1 and 2, :rock:workout:, should give me songs 1, 2, 4, and so on. Is there some package for that today, or some similar feature in EMMS? I have a org file for a list of favorite games and some tags to filter games based on wether its for pc or some console, if it supports single player mode, 2P, 4P, offline party, online, coop and/or versus, and I can filter the list to find the best games to play with my friends or by myself, and it works pretty well. submitted by /u/AkaIgor [link] [comments]

i've been looking for good repl for javascript. Something like Slime or Cider or m-x run-python. it needs to support: auto completions in repl auto completions in buffers that are connected / associated to js repl process multiple repls code navigation (optional, i know its hard to implement) I've been only able to find abandoned and/or non-working projects https://github.com/NicolasPetton/Indium (didn't work) https://github.com/Gozala/slime-js (abandoned) https://github.com/skeeto/skewer-mode (no auto-completion) https://js-comint-el.sourceforge.net/ (no auto-completion, no associated buffer auto completion) https://github.com/abicky/nodejs-repl.el (no associated buffer auto completion) note: lsp is not what i'm looking for. submitted by /u/dirty-sock-coder-64 [link] [comments]

On my Mac, when I open Emacs via an "emacs xxxx &" command on the command line, it adds an Emacs icon to the middle of the dock (the part between the left part with icons for launching apps and the right part with icons for minimized windows). However, when I exit Emacs, that icon remains in the dock (middle section), so if I open Emacs (the same way) again, I get yet another Emacs icon. Why is Emacs and/or MacOS doing that, especially the multiple icons? (But also, why is it not "activating" the Emacs icons that's already in the left part of my Dock (that is, displaying the little black "app is running" dot below the icon)?) Thanks. submitted by /u/DanSWE [link] [comments]

I try to make a function for Dired that list only some files having some keywords in the filename. For instance in a folder I have some files listed in dired formatted like "Interactive Chart in Excel - Dashboard Reporting Tips__Excel.mp4", I would like to do an interactive function that retrieve all keywords prefixed by two underscores (in the example "Excel"). The user should selected a keyword from list retrieved and then mark all files containing the keyword. I try with this function but it's not working as expected. Could you help me on this ? (defun my-dired-filter-by-keyword () "Filter Dired files based on a chosen keyword from filenames." (interactive) (let* ((files (directory-files default-directory nil "^[^.].*")) ;; Get all files, excluding those starting with '.' (keywords (cl-remove-duplicates ;; Use cl-remove-duplicates to avoid duplicate keywords (delq nil ;; Remove nil entries from the resulting list (mapcar (lambda (file) (when (string-match "\(__\)\(.*\)\([\.]\)" file) (match-string 2 file))) ;; Extract the keyword files))))) (if keywords (let ((keyword (completing-read "Choose a keyword: " keywords))) ;; Filter Dired based on the selected keyword (dired-mark-files-regexp (concat "__" (regexp-quote keyword) "\\.")) (dired-toggle-marks) (dired-do-query-replace-regexp (concat "__" (regexp-quote keyword) "\\.") "" nil) ) (message "No keywords found.")))) submitted by /u/vietoonet [link] [comments]

As a user of doom emacs and previously using vim to edit files quickly, I found it easy to use the vim keybindings in other text editors and programs. I heard that the emacs keybindings are quite useful aswell but also heard that they are quite hard with a soft pinky finger. I do not know the emacs keybindings and it would be easier to use it in the emacs environment as it was designed to be used there but is it really worth all the trouble? submitted by /u/Tiny-Influence-7726 [link] [comments]

Hey everyone, I've wanted to use the `compile` command for a while but I found it annoying that it doesn't give you auto complete based on previous commands you have run. I tried to search how to get this effect since I assumed other would have wanted it too but to my surprise my google-foo failed me. I ended up reading some emacs docs and to my surprise it wasn't that hard to do, so I want to share my solution here, potentially to help others who care about this and maybe to get feedback on my solution since over all I'm relatively new to 'hacking' emacs. My solution involves overwritting the `compilation-read-command` function to hook it up with `completing-read`, and since I use vertico I get a nice completion ui around it in the minibuffer. ;; compilation-read-command uses `read-shell-command` by default, which doesn't use ;; completion at all. So I overwrite it to use `completing-read` instead, which seems to work great. (defun compilation-read-command (command) (completing-read "Compile command: " compile-history nil nil command (if (equal (car compile-history) command) '(compile-history . 1) 'compile-history))) submitted by /u/Enip0 [link] [comments]

I did a little bit of research in this, and apparently docker-tramp https://github.com/emacs-pe/docker-tramp.el can allow someone to access docker from within emacs and but now this feature is built-in in emacs >= 29. The reason I brought up even docker tramp is the website says that someone can do the same things with podman for these emacs version. I know there is a docker package in emacs that allows it to manage docker containers witihin emacs. But I don't need that level of control for podman. What do I need, as the title says, is to access the podman containers. To clarify futher, what I want to do is: say when I am working on a project and I want to evaluate a snippet of code using C-c C-c inside a org src code block, I don't want emacs to use my system's environment but the environment of the specific container I would like to use. If it were a whole file, eg, I would simply enter the podman container using eshell/vterm and evaluate the document, but, when I am writing in prog-mode instead of org-mode, the formatters and linters for that program would work if they are installed in the main system. But how do I use podman containters stuff? I mean there is good document, I think, for docker but not so much for podman. I tried researching on this but I could not find any example code since I don't know lisp to write my own. But I really could use someone's help in writing one. Maybe, since docker and tramp are related, going through tramp manual I might find some help. But has anyone here tried setting up emacs the way I want and used podman? And would it be easy to set up like that? EDIT: Sorry for not just paragraphing it properly. But the post did not even make any sense. My dyslexia kicked in and made such brutal mistakes. Appreciate the patience, and hope the post makes sense now. EDIT: Just to further clarify, emacs is not installed inside the container but installed in the system. submitted by /u/whatever4123 [link] [comments]

I've recently followed the getting started guide to install Doom Emacs on Windows 10 but ran into an odd issue that I'm wondering if others have seen/know the answer to. So within Emacs itself, attempting to reload with either "doom/reload" or "SPC h r r" opens up Notepad with "doom.ps1", the Powershell file. Closing the Notepad window prompts the "config successfully reloaded!" message in Emacs, but fails to load any changes. Does anyone know what the deal is with that? submitted by /u/Substantial_Staff603 [link] [comments]

The color and width of the window divider set by Prot's theme is too narrow for my liking and for some reason the function I use to set it cannot change the colour and widen to my preferences. I believe his themes use a different method for that. Here is the code I use to set mine. I don't know of there are some additional settings used for the borders my code doesn't account for. (defun set-window-borders-config() (setq window-divider-default-places t) (setq window-divider-default-right-width 4) (setq window-divider-default-bottom-width 4) (set-face-foreground 'vertical-border "green") (window-divider-mode) ) submitted by /u/vfclists [link] [comments]

submitted by /u/peterb12 [link] [comments]

The clang-format package has been updated to version 20241019.2151.

The zoom package has been updated to version 20241019.2101.

The tide package has been updated to version 20241019.2101.

The darkman package has been updated to version 20241019.1404.

The selected-window-accent-mode package has been updated to version 20241019.1342.

The ebib package has been updated to version 20241019.1310.

The js-comint package has been updated to version 20241019.1216.

The exercism package has been updated to version 20241019.1120.

The cort package has been updated to version 20241019.936.

The futhark-mode package has been updated to version 20241019.935.

The anki-editor package has been updated to version 20241019.726.

The magit-section package has been updated to version 20241019.205.

hi everybody I am trying to create a custom section to the agenda (at the end, using org-agenda-finalize-hook) My goal is to add some hyperlinks to files in this agenda. I am able to create the section and add text with properties, but I have discovered that org-mode style links do not work (they are simply rendered as text). Does anybody have any recommendation on where to look for information on how to do this? Ideally I would like to insert links similar to those already supported in org (eg. [[uri][description]]). Edit: surprisingly, both the URL and description are links and work! but they are not properly rendered (the braces and the uri are not hidden) thank you submitted by /u/dm_g [link] [comments]

I live in Serbia and I like local cookies Plasma. Yesterday I saw how this colors combination is pretty. And firmly decided "I'll do this!". It was my first time creating color scheme and as templates I used other themes which were under my hand. What you think about it? https://github.com/Prikaz98/plasma-theme https://preview.redd.it/9ogyxko0dqvd1.png?width=500&format=png&auto=webp&s=ea281e026ae84aa8631b052d54c5b45ddac3731e emacs doom-emacs submitted by /u/Cautious_Truth_9094 [link] [comments]

This is a continuation of the thread Developers Have Jobs to Do. I took the time to document my experience installing emacs and bedrock, and configuring it for python development. The immediate goal is great Emacs support for python developers accessible via Github. https://github.com/gregfelice/emacs-dx/blob/main/emacs-dx-profile-python-developer.md A summary analysis: bedrock can be an accelerant leading to a good experience for python. work needs to be done to get to a good python development ux out of the box. external dependency guidance (and hopefully more automated setup) is critical. Next steps: get in touch with bedrock authors. see if they could help answer some of the questions raised by the research. get feedback from community: emacs-dx issues is open on github. feel free to create an issue if 1) you have some guidance (or code) that solves a problem raised by the research 2) you have something you'd like to see offered in the python developer profile. Thanks. submitted by /u/grokgov1969 [link] [comments]

Hey all. When using emacs in a terminal (with -nw option), are you meant to see the autocompletion drop down suggestion list as you type? Similar to neovim? I only see this behavior when running in the emacs client but not the terminal. Am I missing something or is the maybe a problem with doom emacs? submitted by /u/dirtyfishtank [link] [comments]

Hello. I've been trying to use Magit more and wean myself off og github desktop recently, but there's one thing that has been bugging me. Magit seems to only accept password credentials for github pushes, but password credentials to push to github have been deprecieated. Is there any way around this? Thanks in advance. submitted by /u/RadioRavenRide [link] [comments]

Hi, I like reading pdfs while them being set up to occupy the whole width of my screen so text is really large, however as I'm working in continous mode I sometimes get lost when going from one page to the next one. I want to know if there's a way of putting an indicator or marker to the right of the pdf buffer to visually represent what the modeline already shows: top - % - bottom. Much like in the fashion of gsap markers used during development submitted by /u/bloomingFemme [link] [comments]

I just discover org-margin. I think it would be nice if I can use org margin just like org indent mode with startup options. I tried to look at how startup options works, but I found out that it was not designed to be easily customized. Have anyone done the customization of startup options before? edit: what I mean is that I want to add a startup option to enable org-margin-mode locally just like how I can do with org-indent-mode. Like #+startup: margin to enable org-margin-mode. submitted by /u/Ok_War_5515 [link] [comments]

I have been searching a way to change the ellipsis (the "...") shown by hs-minor-mode. It turns out the solution here solves my problem. I hope this can help people with the same issue. By the way, hs-minor-mode is a good built-in code folding package. If you don't want a minimal setup, try this one! submitted by /u/linwaytin [link] [comments]

I've googled for about 1.5 hours and I can't find a solution for this. Using my local MacBook to edit a file with Emacs on a remote MacMini via SSH+Tramp: `^X^F/scp:mac-mini:bin/new-shell-script.sh` When I open the file, Emacs automatically changes the file-endings to 'Mac' conventions: Mode line: `U(Mac)...` This is the wrong file ending convention and the script will fail when I try to run it which results in a head-scratching debugging session. Clicking the 'M' and U(Mac)... changes the file ending standard to utf-8-unix and saves the file but then Tramp immediately changes the convention back to the wrong file ending conventions. This sets me up for another WTF debugging session. I've tried setting the file conventions with a local buffer variable but that doesn't help as the file immediately reverts to Mac line endings after each save. I have two questions: Q: First, I'm just looking for a work around here. Can I put something into my: `# -*- mode: shellscript; ... -*-` mode line that will force my desired file ending convention? Emacs and Tramp seem to be convinced that in this environment is should be utf-8-hfs-mac when I want utf-8-unix. I'm looking for a file-local temporary fix here but google seems to be convinced that I'm better off chasing the setting of these variable each time I have a problem like this and I do actually use TRAMP to edit files on foreign filesystems irregularly. So, most of the time TRAMP gets this right, it's just that this time, TRAMP is getting it wrong which is adding 3 items to my debugging stack making a simple problem hard to debug. Q: Second, I've searched for about 1.5 hours along the subjects of "emacs line endings", "emacs normal mode", "emacs mode-line" and none of them have answered my question. What subject should I be searching for to fix this? submitted by /u/cshilton [link] [comments]

Hi everyone,I am interested in the note box system and would like to know which fonts are particularly suitable for the design of the notes. Are there any recommendations for fonts that are both aesthetically pleasing and functional? I studied art and wonder if, for example, a tree in Helvetica creates a different mental stimulus than the same tree in Roboto. Are there any studies or personal experiences on this? I look forward to your answers! John  ( 3 min )

submitted by /u/peterb12 [link] [comments]

I'm trying to create a major mode for syntax highlighting a query language that I use. However, the language has highlighting of variables in very different contexts. Where regular expressions might work, it feels far too complicated to use. The way forward, it seems, would be to use something that is syntax-aware. This realistically seems like the only way to do what I want. I asked ChatGPT and it suggested tree sitter. I know that tree sitter support is now natively in Emacs as of 29.1. I've never used it before. Is tree sitter the best thing to use for creating a syntax highlighting mode that is grammar-aware? Or would there be another way? submitted by /u/CountMoosuch [link] [comments]

submitted by /u/jamescherti [link] [comments]

Not sure how many have seen this, but--if you're an Emacs user, it's hilarious. https://www.youtube.com/watch?v=urcL86UpqZc submitted by /u/zenwrite [link] [comments]

All in the thread: Thanks for the discussion and feedback on the idea. It's helped shape a direction for this. Will be working on some el code to prototype what we're discussing here, and will share back. Appreciate your time. Hi community. I've used Emacs for over 30 years. I've recently started using it again for python and react development. While I love some of what Emacs has to offer, it's continued to be a frustrating and problematic ramp. It's hard to get it where I need it as a professional developer. Even after all these years, I still feel Emacs has so much untapped potential, but there's problems holding it back. Rather than just walk away, I decided to write up and share my ideas. I want to give back to Emacs by collaborating on a solution that gets it used and driving real value for more people. The document shares ideas on how to help developers quickly get productive with Emacs on the tasks that matter to them. I deeply believe we can increase the number of developers who try Emacs, get value quickly enough to use it more, and promote its virtues to friends. https://github.com/gregfelice/emacs-dx/tree/main if you want to help build and launch this, hit me up on https://discord.com/invite/9F4DSE25r7 submitted by /u/grokgov1969 [link] [comments]

https://preview.redd.it/wylnk0a0thvd1.png?width=682&format=png&auto=webp&s=d6e7fc99e6a28ee32ab3acb8b90569465c78ee91 Limited CSS support. Details: https://lifeofpenguin.blogspot.com/2024/09/html-renderer.html#css submitted by /u/atamariya [link] [comments]

i'm using doom but i feel like i'm not having full fun in emacs so thought of disabling evil mode and now i feel like it's fun to use emacs as i'm learning newer keybindings i have mapped caps key to be escape systemwide but i want the caps key(now escape) to be control key while using emacs so wanted to know if there was in emacs to make escape key to be control key submitted by /u/GiGaBIT_username [link] [comments]

Recently, I've been trying to bind TAB to tempel-next for jumping between placeholders in snippets, but it fails in the GUI version. However, when I tried it in TUI, it worked successfully, which confuses me. ``lisp (after! tempel (use-package! tempel :bind (("M-y" . tempel-complete) :map tempel-map ("M-j" . tempel-next) ("M-k" . tempel-previous) ("TAB" . tempel-next) ("S-TAB" . tempel-previous)) :init ;; Setup completion at point (defun tempel-setup-capf () ;; Add the Tempel Capf tocompletion-at-point-functions'. ;; tempel-expand' only triggers on exact matches. Alternatively use ;;tempel-complete' if you want to see all matches, but then you ;; should also configure tempel-trigger-prefix', such that Tempel ;; does not trigger too often when you don't expect it. NOTE: We add ;;tempel-expand' before the main programming mode Capf, such ;; that it will be tried first. (setq-local completion-at-point-functions (cons #'tempel-complete completion-at-point-functions))) (add-hook 'conf-mode-hook 'tempel-setup-capf) (add-hook 'prog-mode-hook 'tempel-setup-capf) (add-hook 'text-mode-hook 'tempel-setup-capf))) ``` In the GUI version, TAB always triggers indent-for-tab-command. I'm using Doom Emacs with Evil mode enabled. Any insights from the experts? submitted by /u/Professional-Hour288 [link] [comments]

Context: Novelist/filmmaker who primarily uses NeoVim for all my prose and screenwriting, and for note-taking via Zettlekasten system since 2020. I also put together a an Integrated Writing Environment (IWE) for NeoVim for other users like me. I even spoke at a couple of NeoVim confs since then. Suffice to say I love NeoVim. I also love tinkering with my computers endlessly when I am not working, naturally my brain has always been interested in seeing what emacs can do. Tried Emacs for the last 3 years, but kept hitting a wall. Or just plain frustration. Until I tried this Emacs kickstarter for NeoVim users. And everything clicked. I had a few _oh shit_ moments the last few days. Can't say I am a convert yet - I still think Vim motions is subjectively better for pure text manipulation - but for pure hackable joy, emacs all the way. So far: Moved from using Org mode in NeoVim to Emacs. I give myself an hour everyday where I turn off evil mode and just use pure emacs bindings. I still feel like I am playing jazz piano but it is now almost intuitive. Started browsing some documentation sites purely through eww I can control spotify?! Things that aren't working yet: LaTeX live previewing. Can't figure out why because my Tex installation works perfectly on NeoVim using vimtex. I'll figure it out in a couple of days Carry on. TLDR: I (almost) see the light. submitted by /u/DevMahasen [link] [comments]

I was reading a lot about the multithreading is not necessary or maybe it is implemented with (heavy) threads in emacs. If I red well we can use the async package and reach the "async" functionality with it ... So my question is that how I can preload the org mode in the background ? use case: I open the emacs every morning and I start to read a file or do something ... I used to open my daily.org file but I have to wait a lot because to load the org package is very slow (~5-10 sec)... I'm using win10 or win11 and I know it is because the windows os but I thought that maybe we can preload the org mode in the background :) do you know any solution for this ? If I think well the witheditor is working like I open a file with emacsclientw.exe ... so maybe I can use this one to preload the daily.org in the background ... I don't know what is the trick in the async package so maybe any guidance is needed if I can solve this issue with this package ... I know we should load a package in the ui thread but what is if I open an org file with an emacsclient, will it freeze my every emacs frames for this short (5-10sec) period ? submitted by /u/zsome [link] [comments]

I'm mostly doing python programming with Python using emacs and LSP. Sometimes I switch to Code to prototype some notebooks. Now I thought the last step can also be done in org-mode which suits me better ( No switching to Code). However, I seem to be loosing all LSP functionalities and basically I'm on my own. Any idea how I can deal with this inconvenience? submitted by /u/tengisCC [link] [comments]

Been using Emacs in various terminals for the past six years with the following setup: Powershell: Windows terminal emulator, running wsl iTerm2: macOS terminal emulator Terminal: whatever is default installed in Ubuntu/Crostini Termux: terminal emulator on Android, with Unexpected Keyboard (available on F-Droid) for full keyboard Zsh: cross platform shell with a bunch of plugins for auto completion Mosh: ssh client that auto-reconnects without losing session information GNU Screen: Outer layer of multiplexing terminal sessions, allows switching between multiple tmux sessions in a single terminal window Tmux: Inner layer of multiplexing, hosts various emacs instances for whatever I'm working on Emacs: default keybindings, MELPA package repo, magit, various lsps (python, typescript, elixir), flycheck, company On system startup my launch procedure is: mosh , screen, tmux, emacs -nw Haven't had to change any key bindings and can easily switch through panes/sessions without ever touching my mouse on laptop. What is your emacs terminal setup? I haven't changed mine in years, so I'd like to hear about others' setups and try some new things! submitted by /u/fallsoftco [link] [comments]

I found there is an mode-line-format-right-align can let rest element right align, but I want to let one element in mode-line-format align in the middle, is it possible? How? submitted by /u/eval-exec [link] [comments]

The flex-compile package has been updated to version 20241018.2140.

The transient package has been updated to version 20241018.1740.

The forge package has been updated to version 20241018.1648.

The outline-indent package has been updated to version 20241018.1531.

The flycheck-languagetool package has been updated to version 20241018.1225.

The ipe package has been updated to version 20241018.749.

The leaf package has been updated to version 20241018.516.

The apheleia package has been updated to version 20241018.35.

details at https://contributors.scala-lang.org/t/broken-scala-3-6-0-release/6792 submitted by /u/Seth_Lightbend [link] [comments]

submitted by /u/ybamelcash [link] [comments]

```haskell module Main where import Control.Exception (SomeException, try) import Control.Monad (when) import Data.ByteString.Char8 (ByteString, unpack) import Data.Either (isRight) import Network.HTTP.Simple (getResponseBody, httpBS, parseRequest) main :: IO () main = do let urls = mapM_ ( \url -> do putStrLn $ "fetching " ++ url res pure () Right dat -> putStrLn $ "process " ++ show (length (unpack dat) div 1024) ) urls fetchUrl :: String -> IO ByteString fetchUrl url = do req >= pure . getResponseBody pure res ``` after compiling a binary and running it, it almost always crashes with a couple of errors: bus error gets stuck and then my Apple M3 Pro (36GB RAM) complains that I've run out of memory extremely rarely, I get a malloc error where it says there was some error in re-alloc. submitted by /u/chandru89new [link] [comments]

I'm trying to fetch https://rest.uniprot.org/uniprotkb/P12345.fasta in my application. Curl works fine: ``` % curl https://rest.uniprot.org/uniprotkb/P12345.fasta sp|P12345|AATM_RABIT Aspartate aminotransferase, mitochondrial OS=Oryctolagus cuniculus OX=9986 GN=GOT2 PE=1 SV=2 MALLHSARVLSGVASAFHPGLAAAASARASSWWAHVEMGPPDPILGVTEAYKRDTNSKKM NLGVGAYRDDNGKPYVLPSVRKAEAQIAAKGLDKEYLPIGGLAEFCRASAELALGENSEV VKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQSYR YYDPKTCGFDFTGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFA FFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVICKDADE AKRVESQLKILIRPMYSNPPIHGARIASTILTSPDLRKQWLQEVKGMADRIIGMRTQLVS NLKKEGSTHSWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVGY LAHAIHQVTK ``` Python works fine: ``` import requests requests.get('https://rest.u…

submitted by /u/peterb12 [link] [comments]

I mean both 'deriving' and 'deriving via' -- these are absolutely amazing features of Haskell. I think a lot of haskellers just use them without giving it much thought. But my question: what other languages offer such features? I know OCaml has its ppx mechanism that lets you do this (viz: ppx_deriving with more information on such things at the Ocaml metaprogramming page). I can't actually think of other languages that do it in quite this way. Of course a lot of very dynamic languages (in the SmallTalk family) let you do this. So I'm mainly interested in 1) typed languages (sorry Racket, doing 'TypedRacket' with macros is very cool, but quite different; a 'deriving' mechanism *for* TypedRacket would be in scope, if it exists) and 2) where this is done in a wholly separate phase, i.e. not at run-time. submitted by /u/carette [link] [comments]

I am an low / intermediate Java and Fortran programmer, and I am interested in broadening my knowledge beyond object-oriented programming, and since I have liking for "Vintage" stuff, and for high skill curves, I figured why not try Haskell. The issue is that I have been pulling my hair out trying to get VSC to run my Haskell code, and was wondering one of the following: Is there an equivalent to Java's BlueJ in the respect that it is an easy all-in-one editor, compiler, and terminal that does not need any dependencies preinstalled, or if there is just a simple way to get Haskell running in VSC that I'm not familiar with. Honestly, considering how much time I have dumped into trying to get VSC to work I would prefer an equivalent to BlueJ at this point. Considering how refined VSC is, it's definitely just a skill issue that I've failed to get this to work lol. submitted by /u/theskewb [link] [comments]

Hey Haskellers! We're excited to let you know that the Call for Proposals for Functional Conf 2025 is now open. This is your chance to connect with a community of passionate FP enthusiasts and share your unique insights and projects. Got a cool story about how you used Haskell to solve a challenging problem? Maybe you've pioneered a novel application, or you have experiences that others could learn from. We want to hear from you! We're on the lookout for deep technical content that showcases the power of functional programming. We're also super committed to diversity and transparency, so all proposals will be made public for the community to check out and weigh in on. Got something unique, well-thought-out, and ready to present? Then you stand a great chance! Submit your proposal and be a part of making Functional Conf 2025 an amazing event. Don't sleep on it—submit today and let's push the boundaries of FP together! Submission deadline: 17 November 2024 Functional Conf is an online event running 24-25 January 2025. https://preview.redd.it/44wk0ke0kfvd1.png?width=1920&format=png&auto=webp&s=79d1cf9db86e430921e5f85979b247faa314960b submitted by /u/yourdigitalvoice [link] [comments]

Zettelkasten Workflow I wrote it in obsidian and shared it using miro. It was easy to understand visually and share freely on the web, so I decided to use the I think I will utilize it a lot in the future How do you share your own notes?  ( 4 min )

Hi all, I am wondering if one can use an org-file for cron jobs. Benefits would be all the structure/folding/navigation benefit and everything (logging + code) would be in one place. On a theoretical level: Is this smart or dumb? Curios what your opinions are! And on a practical level: How can I let "org-babel-load-file" update the #+RESULTS section? I have this MWE: #+title: Cronjobs #+begin_src emacs-lisp :results output prepend (princ (concat "I'm here because someone run the code block at " (current-time-string) ".")) #+end_src #+RESULTS: : I'm here because someone run the code block at Fri Oct 18 08:39:30 2024. : I'm here because someone run the code block at Fri Oct 18 08:39:27 2024. But the printed results came from C-c C-c-ing the code block. Running org-babel-load-file does print the message but doesn't modify the file... Best Jonas submitted by /u/jonas37 [link] [comments]

submitted by /u/kosakgroove [link] [comments]

Hello lovely Emacs community, I've been coding with emacs since 1984. That's a long time. Over the years I've been forced by work circumstances to use various IDE's, including more recently vscode (like everybody) but despite adding "emacs modes" to these IDE's they just were never really just... emacs. My young coworker asked me this week why in fact do I use emacs. He's a thirty-something and had never even heard of it. I didn't have a great answer... muscle memory? learned in college? macros? it works the same everywhere? highly portable? All these answers are somewhat... outdated these days. That said, whenever I'm forced to use vscode, and even think about a mouse when coding, I loathe it. That hatred of the IDE slows me down. Vscode is so visually busy with so many flyovers and "he…

Is this normal? Everytime I use a command in the remote machine such as docker, kubectl, etc. I get a "Opening connection {cmd_name} for ...". It takes seconds to give me the output of the command; but if I just SSH in and type the same commands it is instant. I ran emacs -Q to make sure it isn't my config. Then I ran (setq tramp-verbose 6). Then I ran docker --version as an example. Here's the relevant debug output: /ssh:{ip}/:~ $ docker --version Last login: Thu Oct 17 17:17:57 2024 from 10.102.207.254 -bash: warning: setlocale: LC_ALL: cannot change locale (en_US.UTF-8) 18:18:11.122187 tramp-process-actions (3) # Waiting for prompts from remote shell...done 18:18:11.122222 tramp-maybe-open-connection (3) # Opening connection docker for {ip} using ssh...done 18:18:11.122491 tramp-m…

https://survey.stackoverflow.co/2024/technology/#1-integrated-development-environment Emacs being lower than nano actually surprised me submitted by /u/g0atdude [link] [comments]

Hi there, do you know of any way to have an Agenda view, or Super Agenda, or org-ql that will show entries with the last note next to it (or under it)? And the date of such note. I have TODO items that can be there for years (ie, awaiting court ruling) and the date & content of the last note is the most useful thing during a review of entries. submitted by /u/telenieko [link] [comments]

inb4 pen and paper submitted by /u/ismbks [link] [comments]

Hi all. Some months ago I switched to Emacs, and right now I'm using as WM with EXWM and as clojure editor. I must say my config file is totally based in other config file I followed from System Crafter videos. I'm so happy and want to get more and more from Emacs. I use Intelij IDEA to develop on a Java project with Cuba framework, and I would like to use emacs instead. Mostly I only need autocompletion, Fast Class switching, Go to definition and so on...and launch gradle tasks like build, deploy. The things is I don't have idea how. I followed the config from the video "From Vanilla Emacs to Java" but I don't get autocompletion at all. Thanks submitted by /u/DevGiuDev [link] [comments]

I use Corfu, and I'd like to try using the built-in tex-mode/latex-mode instead of Auctex. The built-in latex-mode provides the latex-complete-data function for completion-at-point-functions, but it doesn't seem to work, and it contains ;; TODO: Complete commands. in it's source... How can I get latex completions? I know there are LaTeX LSPs, is that my only option? submitted by /u/mn_malavida [link] [comments]

Hi, everyone! I am preparing a meetup for my colleagues titled "Why Emacs is the Best". My goal is to increase the number of people using Emacs for development at my workplace. So, I’d like to ask: Why did you switch to Emacs from another IDE? Why do you think Emacs is the best? Can you share your opinion and experience submitted by /u/mc_shatz [link] [comments]

I am not sure but I think `helm-next-line` should automatically go into next source(helm-next-source) when on bottom of the current source. But recently, this was not true for me any more. Like in the gif. when `C-n` on the line before `Git branches`, should focus the line `* master 48730a4 up`. Can you help me with that? Thanks! https://i.redd.it/o6mpapiwy9vd1.gif submitted by /u/cmal_0807 [link] [comments]

Hi everyone, I use Org-mode for task management and note-taking, and I’m wondering if there’s a voice-powered workflow to capture entries hands-free via voice commands or speech-to-text. Tools like OpenAI Whisper exist, but I haven’t seen anything that integrates them directly with Org-mode for capturing tasks or notes. Has anyone seen or built a solution for this? I’m on Emacs with arch and android (termux). Thanks! submitted by /u/Few-Adhesiveness3474 [link] [comments]

I haven't figured out how to get the built-in JSON mode to handle a buffer containing multiple objects well. The needs comes up when I look at the structured logs of systems that output JSONL. And also when I use ob-http code blocks and its support for piping the response through jq (:select ). Is there another JSON mode that handles this better? submitted by /u/magthe0 [link] [comments]

submitted by /u/Iceland_jack [link] [comments]

So I was writing my Scheme interpreter (like everyone does) but found a problem when implementing closures. Since I use the State monad to manage the symbol environment containing the variables etc. I have to copy it to the closure. This snapshot of the environment is then used any time the function is evaluated. But that means that any changes to the env after the definition are ignored. In scheme later changes can however still affect the closures env: (define n 2) (define foo (lambda (a) (define m 10) (+ a n (- m 3)))) ;; everything after here doesnt belong to the lambda env currently (define n 10) (write (foo 4)) ;; should use n = 10, but still uses n = 2 I know other people have used the IORef to solve this with actual mutability, but I wanted to know if there is another way of still using the state monad, before having to rewrite my entire program. The lambda environment should also affect the actual environment if it mutates an outer variable using set!. submitted by /u/GeroSchorsch [link] [comments]

The treemacs-icons-dired package has been updated to version 20241017.2046.

The mise package has been updated to version 20241017.1826.

The lsp-tailwindcss package has been updated to version 20241017.1524.

The annotate package has been updated to version 20241017.1508.

The org-web-track package has been updated to version 20241017.1353.

The neil package has been updated to version 20241017.1337.

The sqlite-mode-extras package has been updated to version 20241017.1030.

What do you think about open source software bounties? I keep seeing them, for instance SoftwareMill offering them in the ScalaTimes letter today, or com-lihaoyi a while ago, or John DeGoes in his new Golem venture. They seem to offer developers a chance to contribute to open source code, hone their coding skills, get experience, and they might also be getting paid for that work. I considered contributing to one of com-lihaoyi bounties, specifically, implementing support for ms sql. However, I noticed someone else got the torch. And that gets to my point. You have N developers working on the same thing. Sure it works to the advantage of the entity that issued the bounties. But 1 out of the N developers will be successful. What if a developer starts working on it, then drops the ball because it turns out it is too much work and she/he doesn't have enough time? As a matter of fact, com-lihaoyi increased the bounty for ms sql support because there is more work than it was originally anticipated (see the pull request here: https://github.com/com-lihaoyi/scalasql/pull/29 ). Right now, I am not sure where that work is at. I feel that these bounties might drag (some) developers in a rat race. You might argue that a monetary retribution is better than nothing, and in the end nobody forces you to do anything if you don't want to, and I agree 🤷‍♂️ . Maybe I am missing something about how the oss bounties work. I think the ideal process would be to hire a developer to commit and to do the work in a time frame agreed upon by both parties, and to pay her/him properly. But I understand that might not be always feasible due to lack of funds and time, hence the bounties. I would be interesting to see the real-life experience of a someone that issued bounties and how that turned out. submitted by /u/0110001001101100 [link] [comments]

https://github.com/AugustNagro/magnum Magnum is a database client that is focused on high productivity. The 1.3.0 release adds: A Transactor class for customizing SQL transactions Configurable logging and error messages, as well as logging of slow queries Support for arrays of enums in the Postgres module Other small bug fixes and improvements We're working on a variety of new features, like JSON & XML codecs, a ZIO module, embedded Frags, and improved Specs. We'd love your feedback. Enjoy! submitted by /u/augustnagro [link] [comments]

Hi, hope this is not inappropriate -- I saw the monthly jobs thread but it seems to be outdated. We're Codacy, the code quality and security scanning company, and we're looking for 2 Scala developers to join our team of awesome, high-performance, high-ownership developers. You can find all the details on the ad here -- apply directly or feel free to DM me with any questions. We're largely looking for candidates in Portugal or the UK but if you're comfortable working as a b2b contractor within London/Lisbon working hours do also get in touch. https://qamine-portugal.jobs.personio.com/job/1235840?_pc=2298762#apply submitted by /u/CodacyKPC [link] [comments]

submitted by /u/sedhha [link] [comments]

Hy! I worked with scala 2.12-2.13 for years, but in the last 2 years I'm out of the loop. One of my "ongoing" projects has a scala 2.13 codebase, and the owners of the product asked me to start a new product mostly based on the prev codebase. So I need to start a totally fresh project, but I need the ability to fastly convert "old" code to this new codebase. The old toolstack heavily used cats (ET and OT, and SemiGroups), tapir with circe, slick, and akka (mostly streams and http, but some typed actors too). It used a lot of other smaller things like shapeless to help slick with tuples, pureconf for config parsing. Also I had a lot of extender methods and some implicit converters. The questions; - How mature and widely used scala3 is? - Can copilot or other tools convert scala2 code to scala3? - Starting a scala2 codebase in 2024 is a bad idea? - Do we have good learning materials for adoption? - Should I learn new libs if I change to scala3 or I can keep most of my "well known" ones? submitted by /u/tg44 [link] [comments]

Welcome to another issue of Haskell Weekly! Haskell is a safe, purely functional programming language with a fast, concurrent runtime. This is a weekly summary of what’s going on in its community. Featured Developer Nation Survey (ad) Calling All Devs! Help shape the future of development by taking the Developer Nation survey. We’ll donate to charity on your behalf and you could win a Samsung Galaxy Watch 7, a Portable Projector, Raspberry Pi 5s, and many more. A Dictionary of Single-Letter Variable Names by Jack Kelly Haskell’s expressive type system means that type signatures can carry a lot of information. Haskell’s polymorphism means that you sometime write a function that works across an enormous range of types, and are often left wondering “what do I actually call my variables?”. It …  ( 3 min )

Hi guys, Let's say I have a recurring task in Agenda like * TODO Water the flowers weekly SCHEDULED: If I this week decide I instead should water the flowers on friday, I just press the S-RIGHT (org-agenda-do-date-later) But then it (as is described in manual) moves all instances of "Water the flowers" to Fridays. Is there an (easy / built in) way of pushing a single instance of a recurring event forward to Friday, while keeping the rest of the instances on Thursday? My guess is not, as it would require somehow cloning the instance for this week as a new task and leaving the recurring task alone? submitted by /u/w0wt1p [link] [comments]

Hi everyone, I use Org-mode for task management and note-taking, and I’m wondering if there’s a voice-powered workflow to capture entries hands-free via voice commands or speech-to-text. Tools like OpenAI Whisper exist, but I haven’t seen anything that integrates them directly with Org-mode for capturing tasks or notes. Has anyone seen or built a solution for this? I’m on Emacs with Arch and android (termux). Thanks! submitted by /u/Few-Adhesiveness3474 [link] [comments]

At Tweag, we are constantly striving to improve the developer experience by contributing tools and utilities that streamline workflows. We recently completed a project with IMAX, where we learned that they had developed a way to simplify and optimize the process of integrating Google Cloud Storage (GCS) with Bazel. Seeing value in this tool for the broader community, we decided to publish it together under an open source license. In this blog post, we’ll dive into the features, installation, and usage of rules_gcs, and how it provides you with access to private resources. What is rules_gcs? rules_gcs is a Bazel ruleset that facilitates the downloading of files from Google Cloud Storage. It is designed to be a drop-in replacement for Bazel’s http_file and http_archive rules, with features …  ( 10 min )

Hi Haskell. horizon-advance has been updated to support ghc-9.12.1-alpha1. horizon-advance is a package set intended for canary testing new GHC releases with a mix of build concerns covering system libraries, template haskell and type-level libraries. It currently stands at over 600 packages - to get the full list you can run ``` nix flake show 'git+https://gitlab.horizon-haskell.net/package-sets/horizon-advance' ``` For a template using this package set you can head over to the QuickStart section of the manual. https://horizon-haskell.net/QuickStart.html All the best, Dan submitted by /u/locallycompact [link] [comments]

Very new to Haskel, trying to do the above without usage of external libraries. for example “Old McDonald had a farm” would become [“Old” , “McDonald” , “had” , “a” , “farm”] many thanks submitted by /u/Fearless-Wrongdoer [link] [comments]

submitted by /u/kosmikus [link] [comments]

submitted by /u/Worldly_Dish_48 [link] [comments]

Hi, i'm doing small interpreter of simple programming language (as mental exercise), and when i read some post about it i find out an advice to use Fix or Free monad, because in this case i can get advantage of using implicit recursion instead of explicit one. But i don't get the point, because in the end of the day i have to write the same amount of code (probably because i'm stupid, that's why i'm asking :-) ) Here is code snipped of both cases, what am i doing wrong of do not understand? data Expr = Const Int | Add Expr Expr eval :: Expr -> Expr eval c@(Const _) = c eval (Add l r) = plus (eval l) (eval r) plus :: Expr -> Expr -> Expr plus (Const l) (Const r) = Const $ l + r plus _ _ = error "Type error" data ExprF a = ConstF Int | AddF a a type Expr' = Fix ExprF eval' :: Expr' -> Expr' eval' = \case Fix (ConstF n) -> Fix (ConstF n) Fix (AddF l r) -> plus' (eval' l) (eval' r) plus' :: Expr' -> Expr' -> Expr' plus' (Fix (ConstF l)) (Fix (ConstF r)) = Fix (ConstF $ l + r) plus' _ _ = error "Wrong types" submitted by /u/Tempus_Nemini [link] [comments]

It can be done, of course. But is it appropriate? submitted by /u/el_toro_2022 [link] [comments]

submitted by /u/gambpang [link] [comments]

In my org-mode file my content is mainly text in paragraph blocks with a hard return, i.e., blank line in between. I have been searching for a way to get org-mode html export to format this in the literary book style of indented first sentence, and soft returns/no gap lines. I was advised at Stackexchange Emacs to try this #+HTML_HEAD: p { margin-top: 0px; margin-bottom: 0px; text-indent: 2em; } And it worked. However, the fact that this references p is messing up other things in my ox-tufte like giving footnotes that 2em indent, as well as some images. So Plan B is just to use this without the text-indent: 2em; and tack @@html:      @@ in front of all text paragraphs. So now I need a replace-regexp that will do this for paragraphs. M-x replace-regexp RET ^ RET @@html:      @@t RET does it for every line in a buffer, but I need it for every paragraph. Any ideas? submitted by /u/Striking-Structure65 [link] [comments]

This is now part of chatgpt-shell package. M-x chatgpt-shell-quick-modify-region M-x chatgpt-shell-fix-error-at-point Excercise with care. Validate suggestions like we’ve always done (ie. any random stack overflow solution). submitted by /u/xenodium [link] [comments]

Hi everyone, I wanted to share this both for the laughs and maybe some guidance. I am a relatively young programmer, who so far have been my own master, so to speak. I was given big projects to finish on a deadline, but pretty much left to my own devices. All this changed rapidly at this new company. Now, my team leader left the company and got replaced with another one who has never had a managerial position before and is trying to micromanage me, which I resent with a passion, not just because of my character (who if I am being honest, responds well to criticism under conditions) but also because I feel he is not quite on par with my own skill level (perceived or not). I mean, I would ideally like to have a superior who I admire (perceived or not) and can learn from, and then I would embrace and indeed welcome both the manager and the criticism. Anyway, Now how does this relates to Emacs? Well, this guy at work cannot understand the way I program. It seems extremely alien to him because I find myself using common Elisp and functional idioms. I have started naming thinks like (buffer-or-name) or what have you. The use of monoids, etc etc. So, Emacs has forever made me an alien to the standard workplace culture. I mean this guy wants me to take my nicely single purpose functions and put them all within a Class in one huge file. I do not know if I can take it. How is this funny? I do not know, I find it funny that a 50 year old program is causing such trouble for a person 50 years after its inception. Thank you for your time. With <3 pnoul submitted by /u/pnoulis [link] [comments]

I am recently I started developing note-taking package enote [github] which allows you to take notes in file without switching it and it's going well and for now I was wondering if you could recommend anything else I could improve/add to make it better (except choosing colors, window scaling factor and all that customization stuff)? submitted by /u/Unholy_myrrh [link] [comments]

Hi! I've set up a compose key in macOS using compose2keybindings: https://github.com/cmloegcmluin/compose2keybindings?tab=readme-ov-file What this does is turn the right option key into ctrl-shift-f13, which then invokes the compose key. It's working fine it most apps, but it doesn't work at all with Emacs. Pressing the option/compose key makes Emacs say: "C- is undefined". Does anyone in here have any suggestions for how to fix this? I'm not much of a power user myself. I'm running a GUI Emacs 29.4, installed via https://emacsformacosx.com/, with Spacemacs. Thanks! submitted by /u/alexanderberntsen [link] [comments]

This is a thread for smaller, miscellaneous items that might not warrant a full post on their own. See this search for previous "Weekly Tips, Tricks, &c." Threads. Don't feel constrained in regards to what you post, just keep your post vaguely, generally on the topic of emacs. submitted by /u/AutoModerator [link] [comments]

Hi all. Wondering if anyone has successfully set up a functioning lsp for C#. Using Emacs 29.4 on Linux, with LSP mode and flycheck, I've tried: Omnisharp: incredibly slow and unstable, autocomplete dies often, but mostly complete csharp-ls: fairly quick, but chokes on some references (partial classes?) csharp-roslyn: quick, very snappy, works well - except it doesn't detect errors (!?) Between the three of them there's an incredible LSP for me. Any help appreciated. Other details: I have it working fine in VS Code and Sublime Text. Here's my LSP doctor output: Checking for Native JSON support: OK Check emacs supports `read-process-output-max': OK Check `read-process-output-max' default has been changed from 4k: OK Byte compiled against Native JSON: OK `gc-cons-threshold' increased?: OK Using `plist' for deserialized objects?: OPTIONAL Using emacs 28+ with native compilation?: OK submitted by /u/Janzar [link] [comments]

I have the following in my .emacs: (setq my/config-path "D:/Code/etc/emacs/") (defun my/path (subpath) (concat my/config-path subpath)) (add-to-list 'load-path (my/path "lib/")) (setq custom-file (my/path "emacs-custom.el")) (custom-set-variables '(package-selected-packages '( ;; Packages listed below go-mode lua-mode markdown-mode vundo ))) (require 'package) (package-initialize) (setq package-user-dir (my/path "elpa/")) ;;;(add-to-list 'package-archives '("melpa" . "http://melpa.org/packages/")) (unless package-archive-contents (package-refresh-contents t)) (package-install-selected-packages) (package-autoremove) However, when opening a .go file (for example) opens in in Fundamental mode and i can't find go-mode (or any other from the above) in the M-x menu. I have verified the install location and the packages seem to be installed properly. What am I doing wrong? submitted by /u/StarsInTears [link] [comments]

Hey everyone, when fire up M-x: gdb inside Emacs (29.4) on Windows using gdb -i=mi path-to-exe The debugger buffer opens up but can't recognize the MI output of GDB as actual MI output. Error: Either -i=mi wasn’t specified on the GDB command line, or the extra socket couldn’t be established. Consider using M-x gud-gdb instead. The output in the buffer looks like what I'd expect if I ran gdb -i=mi in the terminal, but emacs just won't recognize it as such. Does anybody know if there's an issue with this mode on Windows? I have WinLibs on my path and I'm running emacs directly. If I use MSYS and run that Emacs from within an MSYS shell, things work as expected. I'd like to run Emacs directly and using WinLibs GCC/GDB etc (without going into an MSYS shell). Running gud-gdb works, but I'd really like to use MI instead of the simpler gud-gdb interface. WinLibs version details: g++ (MinGW-W64 x86_64-ucrt-posix-seh, built by Brecht Sanders, r2) 14.2.0 GNU gdb (GDB for MinGW-W64 x86_64, built by Brecht Sanders, r2) 15.2 submitted by /u/nenchev [link] [comments]

I recently saw a post about what keyboard people use for emacs and a lot of people say they use QMK keyboard which allow for custom layout, additional layers. So far the extend of customization I've done regarding keybinds in within emacs itself, I was wondering what emacs specific customization you guys have made to the keyboard itself? submitted by /u/Firm_Evening_8731 [link] [comments]

The shell-maker package has been updated to version 20241016.2009.

The symex package has been updated to version 20241016.1921.

The composer package has been updated to version 20241016.1900.

The flymake-ruff package has been updated to version 20241016.1600.

The emms package has been updated to version 20241016.1218.

The vhdl-ext package has been updated to version 20241016.1217.

The consult package has been updated to version 20241016.1007.

The spdx package has been updated to version 20241016.119.

Announcing new governance structure and release policies for Scala 🥁 🎯 Product-driven decision making processes ✨ Well-defined distributions 🔭 Predictable and frequent releases 🧹 Standardised backlog management 👂 Easier access to maintainers blog post: https://scala-lang.org/news/new-governance.html the two main new pages are: https://scala-lang.org/governance/ https://scala-lang.org/development/ submitted by /u/Seth_Lightbend [link] [comments]

This time during Functional World event, we're stepping a bit outside of functional programming while still keeping developers' needs front and center! The idea for this session actually came from our own team at Scalac, and we thought it was worth sharing with a wider audience :) We hope you'll find it valuable too, especially since more and more projects these days don't have enough dedicated DevOps support. Check out more details about the event here: https://www.meetup.com/functionalworld/events/304040031/?eventOrigin=group_upcoming_events submitted by /u/ComprehensiveSell578 [link] [comments]

Hey, I was wondering if Scala has a library or extension or something where I can use JSON as first-class like it does with XML; see the following example: val sunMass = 1.99e30 val sunRadius = 6.96e8 val star = Sun { sunMass } { sunRadius } { 4 * Math.PI * Math.pow(sunRadius, 2) } { 4/3 * Math.PI * Math.pow(sunRadius, 3) } So exactly like this but with JSON where I can embed/evaluate expressions and store literal JSON as a first-class value in a variable? If not, any languages that do? submitted by /u/SALTBRINEDPICKLE [link] [comments]

Hey r/scala! If you're looking to get hands-on with some cutting-edge tech, check out Ergo. This isn’t a shill for just another blockchain, but an open-source platform packed with advanced scripting and cryptographic tools. You can experiment on the testnet or even fork your own chain to explore its potential. Ergo is built on Scala, and its scripting language, ErgoScript (which is also based on Scala), goes beyond Bitcoin’s scripting by using ErgoTree byte code. This allows for complex coin spending conditions, enabling things like ring signatures, multi-signatures, multiple currencies, atomic swaps, self-replicating scripts, and long-term computations. ErgoTree itself is a typed abstract syntax tree, essentially a smart signature that validates transactions based on custom rules. With Secret Data Predicates (digital signatures, secret keys) and Blockchain Context Predicates (transaction-specific conditions), ErgoTree supports a range of applications beyond crypto, such as (decentralised) CBDCs, new monetary systems, Local Exchange Trading Systems, and pretty much anything else you can think up, can be done on ergo! Many of Ergo’s solutions are grounded in formal research and have been presented at peer-reviewed conferences. While ErgoScript isn’t Turing complete on its own, Turing completeness can be achieved through transaction trees, as outlined in this peer-reviewed paper. For those looking to earn while they learn, there are various bounties up for grabs, with rewards in stablecoins like SigUSD and Gluon Gold. Check out open bounties on the reference client and interpreter/compiler, or join the upcoming ErgoHack. An (incomplete) list of all repositories that use scala can be accessed here submitted by /u/ergo_team [link] [comments]

Is anyone here still using org-drill? In Emacs version 30.0.50 and Org version 9.7.5, it does a great job for my son learning Latin. But when I start a cram session with org-drill-cram, it seems to make use of the saved property :DRILL_LAST_REVIEWED: [Y-10-16 Mi 16:%] (this is the one for today), and it doesn't run, giving me the error message: Not an Org time string: [Y-10-16 Mi 16:%]. Has Org changed so much that this older package org-drill doesn't work properly anymore? Has anyone found a work-around? submitted by /u/TiMueller [link] [comments]

I know almost nothing about orgmode aside from some videos here and there. In terms of programming and code I even know less. I liked apps like Dynalist, Workflowy or Logseq for its infinite outlining capabilities and how fast and easy I could organize my ideas into infinite bullets. However, those apps have strong limitations: aside from Logseq they are cloud based(that makes me fear of losing my notes if the company disappears), they have monthly payment requirements for some features(again not Logseq) and they have clunky use or lack basic outlining things like numbered lists(on mobile at least) and so on. Maybe those apps have workarounds to some of those problems but I ended up here since it seems orgmode solves all of the above problems, free, and it’s expected to last for as long as needed it. It sounds great to be honest. But… Is it too much? Is it too much effort to set up/learn? Will I be able to easily use it on multiple devices like pc, Mac, iOS with basic gdrive or iCloud sync without it being slow or having files rewriting themselves during those sync processes and losing information? I fear I’ll need a masters degree in computer science to write my daily to do list or make a novel writing outline quickly(again I don’t know enough about the app) Any kind of advice would be welcomed. As a side note. I tried obsidian but I absolve need more advanced outline capabilities. Obsidian outlining plugins are way too basic and clunky. submitted by /u/Kino45 [link] [comments]

The kanagawa-themes package has been updated to version 20241015.2237.

The ellama package has been updated to version 20241015.2143.

The lsp-mode package has been updated to version 20241015.1503.

The tomorrow-night-deepblue-theme package has been updated to version 20241015.1457.

The sisyphus package has been updated to version 20241015.1351.

The epkg package has been updated to version 20241015.1238.

The borg package has been updated to version 20241015.1235.

The shenshou package has been updated to version 20241015.1227.

The buffer-name-relative package has been updated to version 20241015.1226.

The pg package has been updated to version 20241015.1204.

The phpactor package has been updated to version 20241015.1105.

The parsebib package has been updated to version 20241015.939.

The org-ai package has been updated to version 20241015.148.

I wanted to announce my MuniHac project going live at https://pointfree-wasm.github.io/. The aim was to port the pointfree command-line utility to WASM running inside browser. Perhaps you might find it useful. Personally it started as an exploration of the state of WASM support in Haskell and it turned out that it’s reasonably easy to get going. You might find the project’s sources useful to get started on your own WASM experiments since it a minimal working application with all the necessary stubs filled in. Please report any suggestions or issues you encounter in the repository. PRs are welcome as well! submitted by /u/serg_foo [link] [comments]

I am trying to create a Functor like typeclass where the elements may have any kind, specifically ones with different arity. Think of a class which encompasses Functor1, Functor2, ... and so on. I have started with a class like: haskell class KFunctor k (f :: k -> Type) where kMap :: somethingLikeAFunction k a b -> f a -> f b Now I need to model somethingLikeAFunction somehow. My idea was to use a GADT or a type family, however, that does not work even for the simple case where the elements are of kind Type. haskell data Function k (a :: k) (b :: k) where SimpleFunction :: (a -> b) -> Function Type a b haskell type family Function k (a :: k) (b :: k) where Function Type a b = a -> b Both fail with "Expected a type, but 'a' has kind 'k'". I am wondering why GHC is not able to unify k with Type? submitted by /u/Simon10100 [link] [comments]

Say I have a function like this: foo = undefined where bar = undefined I can check the signature of foo with :t foo. Is there a way to get the signature of bar? submitted by /u/Jackie213123 [link] [comments]

submitted by /u/nicaudinet [link] [comments]

Hello all, not sure if this is a problem related to Sequoia or to Doom Emacs. After restarting doom and rebuilding the server for pdf-tools I was met with this error: -*- mode: compilation; default-directory: "~/.config/emacs/.local/straight/build-29.3/pdf- tools/build/server/" -*- Comint started at Tue Oct 15 16:45:52 /Users/laptop/.config/emacs/.local/straight/build-29.3/pdf-tools/build/server/autobuild -i / Users/laptop/.config/emacs/.local/straight/build-29.3/pdf-tools/ --------------------------- Installing packages --------------------------- Skipping package installation (already installed) --------------------------- Configuring and compiling --------------------------- autoreconf -i /Users/laptop/.config/emacs/.local/straight/build-29.3/pdf-tools/build/server/autobuild: / opt/homebrew/bin/autoreconf: /usr/bin/perl5.30: bad interpreter: No such file or directory =========================== Build failed. ;o( =========================== Note: maybe try the '-d' option. Comint exited abnormally with code 1 at Tue Oct 15 16:45:53 Autoreconf seems to want to a specific version of Perl published before the current stable release on Homebrew, which is confusing to me as I've been able to build the server just fine prior to today. I've tried updating Autoconf + it's dependencies and it was no use. Was wondering if anyone else has had a similar issue, could I maybe force Autoconf to use my installed version of Perl (5.38.2)? submitted by /u/bosich00 [link] [comments]

Hello, I use eglot, corfu, and eglot-tempel (I also tried yasnippet, and still had a problem). The issue is with rust-analyzer, but I don’t think the exact LSP server should matter If I have a function foo_unique(bar), type f, and select foo_unique, I get a snippet completion, which is good. If, however, I type foo_uniq, it gets completed to foo_unique(…) (so my function is the only candidate), with an ellipsis symbol, cursor at the end, and no snippet interface. What could be the problem? This is clearly not something that should happen. submitted by /u/akho_ [link] [comments]

Hi all. Longtime emacs user here. Something changed a few months ago and I can't pin it down. I frequently use ctl-left/right but they don't work anymore. ctl-h k doesn't even show that I'm pressing a key. My Mac is a 2024 16" M3 Pro running Sonoma 14.6.1. The version of emacs I'm trying to use is 29.4.1 from emascforosx.com and 29.4.2 on RHEL 8.9 via ETX. I also tried emacs -nw on the Linux box accessed via Terminal and ssh. Nada. ctl-up/down work fine. Also, ctl-left/right work in other Mac apps. I've been using alt-left/right but I have years of muscle memory so it's a pain. And a mystery. Any ideas? Things to check? Thanks! submitted by /u/quantum_mattress [link] [comments]

I'd like to set up Magit so that, when I run `magit-status`, if there are untracked files in the repo, the toggle state of the "Untracked files" section is expanded. I've tried searching for this, and reviewing the Magit user manual, and nothing is jumping out at me — is this possible? submitted by /u/genehack [link] [comments]

I'm on GNU emacs 23.3.1 on Solaris 9. submitted by /u/daniel_dlds [link] [comments]

https://github.com/redguardtoo/shenshou Download subtitles from opensubtitles Change log, - support OpenSubtitles.com REST API submitted by /u/redguardtoo [link] [comments]

Howdy, folks. So I kinda table-flipped a bit this week after getting fed up with having to keep moving org-agenda and gpt.el windows to a desired frame position. I went down the layout rabbit hole starting with activities.el and perspective.el being next in the queue. I like the UX of activities.el but I'm not a huge fan of having to create all of the frames I want, place them into desired position, and then save them as an activity. I would prefer to be able to define my layouts in elisp but I don't see a great way to do that with activities.el. Perhaps I've over-looked a possibility? Perhaps there's a way to programmatically define a bookmark that activities.el can then reference? Other ideas? submitted by /u/siliconpa [link] [comments]

With multi-threading and maybe a more efficient language implementation. I'm curious if there's any mature projects out there that supports org mode as a bare minimum. submitted by /u/paesco [link] [comments]

I've been using meow-mode for a while with the default recommended QWERTY key map and was wondering how and if it can get even better. Also any tips regarding meow-mode in general are welcome too! I feel like I've barely scratched the surface when I've recently learned about and copied an org-mode speed keys-like map for meow-mode. Thanks! submitted by /u/Varsatorul [link] [comments]

I am using doom emacs, I want to build my own version of emacs. Is their any newbie friendly guides/documentations to follow? submitted by /u/RVSmooth [link] [comments]

The borders are fine in X mode. But the moment I use a terminal e.g. Kitty / Alacritty etc. I get very thick vertical borders in my tables like this. https://preview.redd.it/fblaademivud1.png?width=710&format=png&auto=webp&s=528b21775671b054a760acdb90641adf28d7c04f I have tried with different fonts but I suspect the choice of character is differently rendered in terminal mode. I am using the org-modern package and Doom etc. Could this be the culprit, if so is there work around for this perhaps the font for tables and border?? submitted by /u/AcanthopterygiiSad51 [link] [comments]

So, I've been successfully using GPTEL with Gemini and Ollama, but I yet to configure it for OpenAI access. I provide a function that returns the API key to the Gptel-api-key variable, but GPTEL still asks me for the OpenAI key. The expression evaluates correctly, the configuration is set to look for the function, yet I still have no luck. What am I overlooking? Is it simply sufficient to setq the gptel-apikey variable or do I need to create a separate make-openai block? Thanks! submitted by /u/vtsaran [link] [comments]

My Quest for a Beautiful Mode Line I recently wanted to try and make my own mode line configuration. I have seen plugins like powerline for emacs and lualine for neovim. I think the colorful "pills" they add to the mode line look nice. They look similar to the power level 10k theme in oh-my-zsh. Examples: Example image from emacs' telephone-line Example image from nvim's lualine Example image from powerlevel10k zsh prompt theme Current Understanding I believe that these are made with essentially a Unicode nerd font at the beginning and/or end of a text region with a colorful background. However, I am unable to replicate this well and it looks rather silly. Difficulties I tried reading some codebases for powerline, telephone-line, lualine, and even powerlevel10k. I think the non-em…

This post talks about an IDE feature that supposedly no does but Intelij (automatically folding function bodies). I feel like this has to be something Emacs can do already, or would be easy to implement on top of treesitter. https://matklad.github.io/2024/10/14/missing-ide-feature.html submitted by /u/celeritasCelery [link] [comments]

I'm having trouble with org-tables. When I hit tab to auto-align table cells after an edit, sometimes a row won't align. Looking into it, it turns out a character, often the pipe | but not always, somehow has a double width. Poking at it with describe-char shows the following: Character code properties: customize what to show name: VERTICAL LINE old-name: VERTICAL BAR general-category: Sm (Symbol, Math) decomposition: (124) ('|') There is an overlay here: From 36582 to 36583 face region priority (nil . 100) window # There are text properties here: display ((min-width ((2 . width)))) face org-table fontified t line-prefix #(" " 0 4 (face org-indent)) org-category "20210913T141637-aiotmlwtf" wrap-prefix #(" " 0 4 (face org-indent)) I turned off various minor modes like visual-wrap-prefix-mode, visual-line-mode, visual-line-column-mode, and aggressive-indent-mode to no avail. So have no idea what causes the insertion of that special character feature. (Running a recent Emacs30.) submitted by /u/art_else [link] [comments]

submitted by /u/bunniechildhood [link] [comments]

Hallo my use case although noble is quite difficult, here the A) Abstract and B) Specific formulation: Abstract I read a lot and want an efficient way to use the information i read inside the books Specific As reader I want to benefit from the content of the books i annotated, and kind of run queries to have the annotations available as i prefer. For instance I could have assigned a tag about a topic to every annotation, or a rating of importance from 1 to 10, and so I could have the need to retrieve the title of the chapters and paragraphs of a book, or the chapters, paraghraphs and notes, or and here becomes interesting all the notes that have a specific rating with a sparse tree (chapters, paragraphs) and notes with importance > 5 or even more interesting across the books with a specific tag as for instance statistics all the notes with a rating >9 IMPLEMENTATION I do not know what is the most convenient way, really I have not idea, but i confine that there are other avid readers that develop org mode that thought about a convenient workflow * annotating pdf of digital documents so that can see on the side the original pdf and another side the notes and assinging multiple tags and running researches across the org files * using org roam to make a kind of wiki using a lot of links,or a lot of org files in subfolders and run a research with a kind of specialized engine to retrieve what I need * see if can use SQL in org files so that for instance the headers of one level would be assigned to a table/column, and the nested ones will be automatically assigned with an id beloging to the table or something similar that will simplify to transform the org mode to SQL * org table files * Some SQL tables in Postgree sql via a star model or model vault key that will be queried in some way inside org mode CONCLUSION All I want is to capitalize the books i read in a way I can extract information, confront sources, highlights, adding notes etc submitted by /u/ivano_GiovSiciliano [link] [comments]

submitted by /u/danielciocirlan [link] [comments]

Is there a keyboard shortcut in Emacs (or Evil, which I use) to close all Literals (#+begin_* sections) in the entire document? Or at least a command that I could bind to a shortcut? submitted by /u/dotancohen [link] [comments]

The nerd-icons package has been updated to version 20241014.2319.

The just-ts-mode package has been updated to version 20241014.2252.

The nndiscourse package has been updated to version 20241014.2001.

The gerrit package has been updated to version 20241014.1940.

The nnreddit package has been updated to version 20241014.1932.

The decide package has been updated to version 20241014.1927.

The easysession package has been updated to version 20241014.1422.

The howm package has been updated to version 20241014.1050.

The yasnippet-snippets package has been updated to version 20241014.949.

The eask package has been updated to version 20241014.738.

The github-linguist package has been updated to version 20241014.601.

The apparmor-mode package has been updated to version 20241014.554.

The org-cite-overlay-sidecar package has been updated to version 20241014.238.

The org-cite-overlay package has been updated to version 20241014.238.

Dan Allosso’s (Obsidisan) Book Club will be reading Bob Doto‘s book A System for Writing (2024) as their next selection. Discussion meetings are via Zoom for 2 hours on Saturdays starting on 2024-10-19 to 11-02 from 8:00 AM – 10:00 AM Pacific. New comers and veterans are all welcome to attend. The book is broken up into 3 parts (approximately 50-75 pages each) and we’ll discuss each on succeeding weeks. The group has several inveterate note takers who are well-acquainted with Zettelkasten methods. If you’d like access to the Obsidian vault, please email danallosso at icloud dot com with your preferred email address to connect to the Dropbox repository. DM either Dan or myself for the Zoom link for the video meetings.  ( 2 min )

It has often been debated here whether we should use folgezettel in the digital context, often contrasted with the "timestamp method". This post is not intended to rekindle that debate (and that false dichotomy, as I now see it), but merely to report my method and how it helps me, in case others find it useful. I exclusively used the timestamp method until I read the Bob Doto book, which completely changed by Zk practice, and now I happily merge the two. First, the benefits of the two methods, as I have seen them expressed here. The timestamp method is flexible, and does not force us to choose a pre-meditated structure; the ZK can grow organically. The folgezettel, on the other hand, helps maintain some coherence in a sequence of notes, keeping the historical context in which notes were ar…  ( 12 min )

When I activate eglot (say, in python-mode) I have the following list of completion-at-point-functions: `eglot-completion-at-point yas-expand t python-completion-at-point` As a result, hitting Tab after a snippet does not work naturally. I would like to ensure that yas-expand has priority over eglot-completion-at-point, what would be most elegant way to do that (I use spacemacs)? Thanks! submitted by /u/Patient_Chance_3795 [link] [comments]

Hi there. I had an idea for a package, but it's the sort of thing that feels like it must already exist, and I'd love to look at existing packages before reinventing the wheel. The basic idea would be that you could schedule code to run using org agenda entries with timestamps. For example, you could write an entry like * Update the package cache :exec: :PROPERTIES: :TaskName: update-package-cache :END: Then you'd define a search like +exec and associate functions to various task names. The package would provide a function/mode to set up timers to watch the agenda and run scheduled tasks when emacs is idle within the scheduled window. Maybe if the entry is a TODO, update the timestamp with org-mark-done. But yeah, this feels like the sort of thing that would already exist in some form. I've seen a few packages to notify about tasks, but not to act on them more generally. If anyone has any leads/thoughts, I'd appreciate it. Thanks! submitted by /u/javajunkie314 [link] [comments]

I've started learning emacs recently, and after some experimentation I decided that I want to experience vanilla emacs navigation keybindings (moving the point around with C-f / C-n etc), without evil/meow/boon etc. I am a casual vim user, and otherwise used JetBrains IDEs for like 15 years now. I'm trying to switch to emacs to be more productive with editing code, because I feel like I use the mouse too much in JetBrains and it slows me down. Needless to say, I am suffering and it feels like torture. My question is that: are the vanilla emacs keybindings viable? Can you get used to it and be as fast as in vim, or as in other editors? Is anyone using the default keybindings, or are you all just rebinding those? If yes, how long it took for you to get used to it? submitted by /u/g0atdude [link] [comments]

submitted by /u/woesies_merry [link] [comments]

I need to access multiple docker containers with the same name deployed on different servers. I connect to then using eshell with command like this: cd "/ssh:username@host|docker:container_name:/" Emacs functions like dired, find-file, etc work fine. However actual shell commands involving binaries on remote do not pick correct host. Emacs somehow remembered the first host that I accessed container with this name first and always runs shell commands there. Even if I explicitly run "/ssh:username@host_that_I_need|docker:container_name:/bin/bash" it always runs "/ssh:username@emacs_favorite_host|docker:container_name:/bin/bash" When I do "C-x C-f" and just type "/docker:container_name:/" it also goes to "emacs_favorite_host". Do I need to configure something or this is how TRAMP normally works? submitted by /u/Free-Combination-773 [link] [comments]

Hey everyone, I have the following line in my Emacs settings file: (setq elpy-project-root "~/Development") However, it doesn't seem to work as expected. I still have to manually call elpy-set-project-root from within Emacs. However, this isn't persistent. As soon as I jump to a file and it resets to the directory of the currently opened file. How can I permanently set the project root in Elpy? Thanks in advance! submitted by /u/monallabs_kabira [link] [comments]

For me, I chang my keyboard to X-Bows, nice lay-out, high quality made. submitted by /u/yibie [link] [comments]

I just merged a project branch I was working on back to [tt]master[/tt] and noticed that some of the pascal files I was working had acquired a [tt].work[/tt] extension, ie filename.pas.work and filename.lfm.work in addition tofilename.pas and [tt]filename.lfm[/tt]. I remember that during the commit process I pressed the wrong key at some stage or clicked in the magit buffer and got prompted about running some kind of git command which I aborted. Could that process have left some temporary files created with the .work extension? submitted by /u/vfclists [link] [comments]

12 Examples - 39 slides https://fpilluminated.com/deck/240 https://preview.redd.it/d5u5dd77zrud1.png?width=1640&format=png&auto=webp&s=72d8599ba9de5bb67023bb9275d94945d30d771e https://preview.redd.it/rfp7xh77zrud1.png?width=1640&format=png&auto=webp&s=270538bb7b254837946bafced68601507847d7a1 submitted by /u/philip_schwarz [link] [comments]

I have been able to set up neovim with HLS in NixOs using home-manager, since i wanted syntax highlighting i added haskell-tools and tree-sitter and made sure to enable its haskell highlighting but... all the highlighting i get is green strings, everything else is white im fairly new to NixOs so i might have made a mistake, especially when im using home-manager to configure neovim (i will leave a part of home.nix in the comments) (if im able to i will also leave a link to a screenshot to show the almost lack of highlighting) i would really appreciate help in setting up the highlighting (every other plugin i enabled works fine) submitted by /u/Eye_Of_Forrest [link] [comments]

submitted by /u/n00bomb [link] [comments]

I have this function to get the handle of a port and maybe convert its exception into a locatable custom error: type EvalResult a = StateT [Env] (ExceptT SchemeError IO) a makePort :: IOMode -> [LispVal] -> Loc -> EvalResult LispVal makePort mode [String filename] loc = do handle throwError $ IOErr err loc Right h -> return $ Port h I can't figure out how to properly lift the try value to match the transformer stack. Right now the error says: "Expected: IO (Either IOError Handle), Actual: t0 IO (Either IOError Handle)" when doing the lift operation. However I dont know how to remove the t0 type-var to properly match the type. Doing liftIO mismatches IO (Either ...) with StateT. submitted by /u/GeroSchorsch [link] [comments]

submitted by /u/Hefty-Necessary7621 [link] [comments]

12 Examples - 39 slides https://fpilluminated.com/deck/240 https://preview.redd.it/kby9ozpeyrud1.png?width=1640&format=png&auto=webp&s=6179a29cb14d4908a43990ca0cf3b9af0850fe01 https://preview.redd.it/a02emypeyrud1.png?width=1640&format=png&auto=webp&s=7e1de4cad573faa11bffbc0934cd2f8381c5e370 submitted by /u/philip_schwarz [link] [comments]

Hi, I’m looking to contribute to some open source Scala projects, primarily to grasp my learnings in Scala, and also to get familiar with the programming design patterns Scala industry follows. What would be some good open source projects to contribute, and if you guys have any, can you let me know ? Thanks submitted by /u/Villain_99 [link] [comments]

submitted by /u/eed3si9n [link] [comments]

It's a collection of small tools, all in once place. One that will probably see the most interest is one that that will tell you what your external IP and location is. Useful if you use VPNs a lot. Another will suspend your computer. And so forth. I will be adding tools to this over time. And your suggestions are welcome. Only Arch is supported at the moment. Pull requests are welcome to support other distros. https://aur.archlinux.org/packages/swiss-army-knife-hs submitted by /u/el_toro_2022 [link] [comments]

Being interested in Miso, I've noticed that it now supports the GHC WebAssembly backend, which is great. One concern I have is that HLS doesn't support the GHC WebAssembly and JS backends. (edit: I have managed to make HLS work with Miso, see comment) I'm interested in using Haskell on the frontend and would like to ask the sub a few questions. If you've used Haskell on the frontend recently, what was your stack and how was your experience? In your opinion, what are the Haskell frontend setups with the best developer experience at the moment? Is Haskell on the frontend with HLS support likely to ever happen? Are there specific problems an individual developer can contribute toward solving to make it possible? submitted by /u/netcafenostalgic [link] [comments]

Reading the thread of remaking emacs in a modern environment, apart from the C-core fixes and improvements, as always there were a lot of comments about elisp. There are a lot of people that criticize elisp. Ones do because they don't like or directly hate the lisp family, they hate the parentheses, believe that it's "unreadable", etc.; others do because they think it would be better if we had common lisp or scheme instead of elisp, a more general lisp instead of a "specialized lisp" (?). Just so you understand a bit better my point of view: I like programming, but I haven't been to university yet, so I probably don't understand a chunk of the most theoric part of programming languages. When I program (and I'm not fiddling with my config), I mainly do so In low level, imperative programming languages (Mostly C, but I've been studying cpp and java) and python. That said, what makes elisp a great language for emacs (for those who it is)? Is it because of it being a functional language? Why? Then, do you feel other functional languages could accomplish the same? Why/why no? Is it because of it being a "meta-programming language"? (whatever that means exactly) why? Then, do you feel other metaprogramming languages could accomplish the same? Why/why no? Is it because of it being reflective? Why? Then do you feel other reflective languages could accomplish the same? Why/why no? Is it because of it being a lisp? Why? Do you think other lisp dialects would be better? Is it because it's easier than other languages to implement the interpreter in C? Thanks submitted by /u/vslavkin [link] [comments]

Good morning everybody, I am glad to say that I'm getting used to elisp. This is my second attempt on making an emacs package. This is called entr-runner.el, it permits to run custom commands on file or directory change directly inside emacs. Check it out on : https://github.com/SamuelVanie/entr-runner.el I'll be happy to get feedbacks on the source code or any other things that will make a student like me a better programmer. submitted by /u/Choice-Strawberry-86 [link] [comments]

After using Spacemacs for long time, I decided to give a try at setting up my vanilla config! I soon noticed that default themes like tango-dark come with highlight face that is too bright for my taste + it removes the coloring from the text it is highlighting, since it sets the whole highlighted text to the same foreground. I ended up setting the face attributes for highlight so that foreground is unspecified, and so that background is darker (I set it to default but darkened a bit further -> I found this works great for any theme, in my opinion. I did a similar thing for region face. The part where I struggle now is consistently executing this on theme-load -> I sometimes change themes and I would love if this get applied after any theme change. I have defined my own hook after-enab…

submitted by /u/petrzapletal [link] [comments]

The yasnippet package has been updated to version 20241013.1557.

The projection package has been updated to version 20241013.1520.

Basically the title. I think I remember reading somewhere it was officially recommended to switch the file extension to .txt and not use the unique .org extension as they are functionally the same. Both are plain text formats, you might just have different txt files, that are not formatted in orgdown there too. Is that all or have I missed something? Is there an actual downside like a dependency of org-roam that you end up in dependency hell if you decide to use txt or another file extension instead of .org. Bc otherwise everytime you don't have an org parser around and are on a system like a tablet, it will straight up refuse to open the file, locking you out of your data complete. This can be avoided by using orgdown formatting, but utilizing the .txt extension. Cheers and thanks for your insights submitted by /u/Gold-Solution7258 [link] [comments]

Is it possible to specify that members of a PROPERTIES block should always come in a specific order? For example, when I create an entry, I set a CREATED property value with the current date. If I change the entry later, I use the org-set-property function to add a MODIFIED property with the date of the change. I would very much like the MODIFIED entry to be inserted immediately following the CREATED property. Is this possible? submitted by /u/oz1cz [link] [comments]

This discussion was created from comments split from: A short wishlist of plug-ins that I would personally get a lot of use out of.  ( 4 min )